Protein WP_009781289.1 in Leeuwenhoekiella blandensis MED217
Annotation: NCBI__GCF_000152985.1:WP_009781289.1
Length: 231 amino acids
Source: GCF_000152985.1 in NCBI
Candidate for 36 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-lysine catabolism | hisP | med | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 43% | 78% | 151 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-glutamate catabolism | gltL | med | GluA aka CGL1950, component of Glutamate porter (characterized) | 41% | 90% | 150.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-arginine catabolism | artP | med | Arginine transport ATP-binding protein ArtM (characterized) | 41% | 85% | 147.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-asparagine catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 41% | 85% | 141.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-aspartate catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 41% | 85% | 141.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-asparagine catabolism | bztD | med | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 41% | 76% | 134.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-aspartate catabolism | bztD | med | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 41% | 76% | 134.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 37% | 62% | 162.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 37% | 62% | 162.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 37% | 62% | 162.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 37% | 62% | 162.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 37% | 62% | 162.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 37% | 62% | 162.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-asparagine catabolism | glnQ | lo | Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) | 40% | 89% | 152.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-maltose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 38% | 62% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 38% | 58% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| sucrose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 38% | 62% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| trehalose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 38% | 62% | 147.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-histidine catabolism | hisP | lo | Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 39% | 84% | 146 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-citrulline catabolism | AO353_03040 | lo | ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) | 34% | 89% | 141.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 37% | 60% | 141.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-mannitol catabolism | mtlK | lo | ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) | 37% | 57% | 141 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 35% | 59% | 140.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 39% | 59% | 140.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-Glucosamine, putative ATPase component (characterized) | 37% | 86% | 139.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-maltose catabolism | malK | lo | ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) | 38% | 54% | 137.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 36% | 54% | 136.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-arabinose catabolism | xacJ | lo | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 35% | 55% | 135.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 33% | 56% | 135.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 35% | 56% | 132.5 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 56% | 131.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 37% | 79% | 129.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-tryptophan catabolism | ecfA2 | lo | Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) | 38% | 75% | 125.9 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| trehalose catabolism | malK | lo | MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) | 34% | 54% | 123.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-histidine catabolism | hutV | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 38% | 76% | 123.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
| L-tryptophan catabolism | ecfA1 | lo | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 35% | 77% | 115.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 58% | 268.1 |
Sequence Analysis Tools
View WP_009781289.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSSLIDITDIRRDFPLGNEIVHVLKGIDLQIDKGEYVAIMGPSGSGKSTLMNLLGCLDTP
TSGTYILNNRDVSAMTDDELAEVRNKEIGFVFQTFNLLPRTTALDNVALPMVYAGYSKPE
RHKRAEEVLQDVGLADRMDHKPNQLSGGQRQRVAVGRALVNKPSIILADEPTGNLDSKTS
VEIMSLFDAIHAAGNTVILVTHEEDIAEHAHRVIRLRDGLIESDVRRTVEV
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory