Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate WP_009778967.1 MED217_RS02835 aquaporin family protein
Query= SwissProt::F9UST3 (238 letters) >NCBI__GCF_000152985.1:WP_009778967.1 Length = 243 Score = 161 bits (407), Expect = 1e-44 Identities = 92/236 (38%), Positives = 130/236 (55%), Gaps = 17/236 (7%) Query: 6 IAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFG---NVCIN 62 IAE +GTAL+I+ G G+ + +L TK G G + T WG + V + + G +N Sbjct: 5 IAEVLGTALLILLGGGIVANDILNKTKGNGGGWMTITTAWGLAVFVGVVVAGPYSGAHLN 64 Query: 63 PAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHFKASTDEISPITIRNLF 122 PA+ + G W+ Y AE +G ++GS +V++MY DHF A+ D R +F Sbjct: 65 PAVTIGLAAGGLFPWADVPTYLAAEFIGAMIGSSLVYVMYKDHFDATEDGGLK---RAVF 121 Query: 123 CTAPAVRNLPRNFFVELFDTFIFISGILAISEIKTP-------GIVPIG---VGLLVWAI 172 CT PA+ N RN E+ TF+ + + S+ + G+ IG V +VW I Sbjct: 122 CTDPAIPNNFRNIVSEILGTFVLLICVFYFSDAEIADGTGTKVGLGSIGAIPVAFVVWGI 181 Query: 173 GMGLGGPTGFAMNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFVGAAIAA 228 G+ LGG TG+A+N ARD+GPRI HAILPI K DS W Y I P + P +GA +AA Sbjct: 182 GLSLGGTTGYAINPARDLGPRIVHAILPIKGKIDSGWSYAWI-PIVGPIIGAVLAA 236 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 243 Length adjustment: 23 Effective length of query: 215 Effective length of database: 220 Effective search space: 47300 Effective search space used: 47300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory