Align N-carbamoylputrescine amidohydrolase (EC 3.5.1.53) (characterized)
to candidate WP_009780182.1 MED217_RS08930 carbon-nitrogen hydrolase
Query= metacyc::MONOMER-17350 (290 letters) >NCBI__GCF_000152985.1:WP_009780182.1 Length = 295 Score = 320 bits (819), Expect = 3e-92 Identities = 150/289 (51%), Positives = 203/289 (70%), Gaps = 2/289 (0%) Query: 3 IALIQQKFHSNKEQTIKKTCEFIEEASKQGAELICLGELHQSEYFCQSENVDFFDYAND- 61 IA++Q ++ E + K +++++A+++GAE+ICL EL+ S YFCQ E+VD F YA Sbjct: 8 IAVLQLALNNTPENNLAKCKKWVKDAAEKGAEIICLPELYSSHYFCQDEDVDNFKYAEPL 67 Query: 62 YEKDVKFWANIARKNQIVLITSLFEKRSAGLYHNTAVVFEKDGSIAGKYRKMHIPDDPCF 121 Y+ ++ +A++ +V+I FEKR +G+YHN+A + + DG+ AG YRKMHIPDDP F Sbjct: 68 YDVSFNEFSALAKELGVVIIVPFFEKRMSGIYHNSAYIIDTDGAEAGLYRKMHIPDDPHF 127 Query: 122 YEKFYFTPGDLGFEPINTSLGKLGVLICWDQWYPEAARIMALKGAEILIYPTAIGWFDKD 181 YEKFYFTPGDLGF+ I T LG LICWDQWYPEAAR+ AL+GAE+L YPTAIGW ++ Sbjct: 128 YEKFYFTPGDLGFKTIKTQKANLGTLICWDQWYPEAARLTALQGAEVLFYPTAIGWHPQE 187 Query: 182 KDEEKQRQLNAWLGVQKGHAIANGLYVVAINRVGFEKDVSGVEEGIRFWGNSFVFGPQGE 241 K++ Q AW+ V KGHA+ANG+YV A NR+G EK V GI FWG SF+ GPQGE Sbjct: 188 KEQFGVNQHGAWMNVMKGHAVANGVYVAAANRIGLEKYVPDT-NGIEFWGQSFICGPQGE 246 Query: 242 ELCLLDSQNECVKIIEIDKKRSENVRRWWPFLRDRRIEYFADLTKRFID 290 L + E + + EID ENVR+ WPF RDRRI+++ ++TKR +D Sbjct: 247 ILAQASADQEEILLAEIDLDLQENVRQNWPFFRDRRIDFYGEITKRALD 295 Lambda K H 0.322 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 295 Length adjustment: 26 Effective length of query: 264 Effective length of database: 269 Effective search space: 71016 Effective search space used: 71016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory