Align Galactarate dehydratase (EC 4.2.1.42) (characterized)
to candidate WP_009779318.1 MED217_RS04610 altronate dehydratase
Query= reanno::WCS417:GFF829 (517 letters) >NCBI__GCF_000152985.1:WP_009779318.1 Length = 538 Score = 227 bits (578), Expect = 9e-64 Identities = 166/526 (31%), Positives = 251/526 (47%), Gaps = 47/526 (8%) Query: 13 IRLHERDNVVIVVNDQGVPAGTEFP-DGLVTVDFIPQSHKVTLEDIPEGGQIIRYGQTIG 71 I++H DNV + + D EF L + HK+ L ++ I YG +G Sbjct: 6 IKVHPDDNVAVALVDLFAGDVVEFEGQSLKILTDSKAKHKIALVNLKADDPIFMYGVLVG 65 Query: 72 YALAPIPRGSWVQEDQLRMPTAPPLDSLPLSTEVPEAQAP----LEGFTFEGYRNADGTV 127 AL+ I G + + ++ +S+ TE AP + TF GY DG V Sbjct: 66 KALSAIDVGGLLTTENVKHEA----NSVSQKTETTSWTAPDISKWKDRTFMGYHREDGQV 121 Query: 128 GTRNILGITTTVQCVTGVL--------------------------------DHAVKRIKD 155 GT+N+ V C + D AV I++ Sbjct: 122 GTQNVWLFFPLVFCENRNIELLKDVFEKELSFHKASKQRQLLRNLINGAPEDTAVAEIEE 181 Query: 156 ELLPKYPHVDDVVALTHSYGCGVAITATDAYIPIRTVRNLARNPNLGGEALVISLGCEKL 215 E + +++ V +TH GCG D+ + + NPN+ G A V+SLGC+ L Sbjct: 182 EQAI-FDNIE-VKFITHQGGCGGI--RQDSVSLSKLLAGYVNNPNVAG-ATVLSLGCQNL 236 Query: 216 QAGQVMHD-NDSSVDLSEPWLYRLQDSSHGFTEMIEQIMALAETRLKKLDQRRRETVPAS 274 Q + + S + +P L Q EM+ +I+ + +KK +Q +R+ P S Sbjct: 237 QIDIFKNALAEKSAAIKKPVLIYEQQQEGTVDEMLAKIIKDSFEGIKKANQIKRQPAPIS 296 Query: 275 ELILGMQCGGSDAFSGITANPALGYASDLLLRAGATVMFSEVTEVRDAIYLLTSRAENTQ 334 +L +G++CGGSD FSGI+ANPALGYASD+L G + + SE E+ L +R + + Sbjct: 297 KLKMGLECGGSDGFSGISANPALGYASDILAAVGGSPILSEFPELCGVEQELVNRCVSDE 356 Query: 335 VAQELVREMDWYDRYLAKGEADRSANTTPGNKKGGLSNIVEKSLGSIVKSGSSAINGVLG 394 A+ + M Y++ + N +PGN K GL KS G+ K G+S I +L Sbjct: 357 DAERFMHLMKAYEKSAVDAGSGFDMNPSPGNIKDGLITDAMKSAGAAKKGGTSPIQAILD 416 Query: 395 PGERFKGKGLIFCATPASDFVCGTLQLAAGMNLHVFTTGRGTPYGLAMAPVVKVSTRTEL 454 GE GL TP +D T + +G ++ VFTTG GTP G +APV+KV++ + L Sbjct: 417 YGEYVTKPGLNLLCTPGNDVESTTAMVGSGASVVVFTTGLGTPTGNPIAPVLKVASNSTL 476 Query: 455 AQRWPDLIDIDAGRIATGRATIEELGWELFHFYLDVASGRKQTWAE 500 A+R PD+IDID+G + G TIEE+G E+ + VASG Q+ A+ Sbjct: 477 ARRMPDIIDIDSGAVIRGEKTIEEMGEEILEHVIQVASGEVQSKAD 522 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 636 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 517 Length of database: 538 Length adjustment: 35 Effective length of query: 482 Effective length of database: 503 Effective search space: 242446 Effective search space used: 242446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory