Align Glycerol facilitator (characterized)
to candidate WP_009778967.1 MED217_RS02835 aquaporin family protein
Query= TCDB::P18156 (274 letters) >NCBI__GCF_000152985.1:WP_009778967.1 Length = 243 Score = 234 bits (597), Expect = 1e-66 Identities = 112/239 (46%), Positives = 152/239 (63%), Gaps = 9/239 (3%) Query: 1 MTAFWGEVIGTMLLIIFGAGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISG 60 MT F EV+GT LLI+ G G+ A L K+ GW+ + WGL V + G SG Sbjct: 1 MTPFIAEVLGTALLILLGGGIVANDILNKTKGNGGGWMTITTAWGLAVFVGVVVAGPYSG 60 Query: 61 AHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGV 120 AHLNPA+TI LA G FPW +VP Y+AA+ IGA+IG+ ++Y+ Y H+ +T+D K V Sbjct: 61 AHLNPAVTIGLAAGGLFPWADVPTYLAAEFIGAMIGSSLVYVMYKDHFDATEDGGLKRAV 120 Query: 121 FSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEG---------LNPLIVGFLIVA 171 F T P+IP+ F N++SE++GTFVL++ + + +G + + V F++ Sbjct: 121 FCTDPAIPNNFRNIVSEILGTFVLLICVFYFSDAEIADGTGTKVGLGSIGAIPVAFVVWG 180 Query: 172 IGISLGGTTGYAINPARDLGPRIAHAFLPIPGKGSSNWKYAWVPVVGPILGGSFGGVFY 230 IG+SLGGTTGYAINPARDLGPRI HA LPI GK S W YAW+P+VGPI+G + + Sbjct: 181 IGLSLGGTTGYAINPARDLGPRIVHAILPIKGKIDSGWSYAWIPIVGPIIGAVLAALLF 239 Lambda K H 0.325 0.142 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 243 Length adjustment: 24 Effective length of query: 250 Effective length of database: 219 Effective search space: 54750 Effective search space used: 54750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory