Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_040533847.1 MED217_RS18300 ABC transporter ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_000152985.1:WP_040533847.1 Length = 308 Score = 116 bits (291), Expect = 7e-31 Identities = 70/222 (31%), Positives = 120/222 (54%), Gaps = 7/222 (3%) Query: 25 LKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVT----NLSTQS 80 LK +D G ++LG SGCGK+TLL II GLL +G + ++ ++ NL Sbjct: 17 LKNLDFTVEKGKHISILGESGCGKSTLLKIIYGLLHVENGTVFWNDNELLGPNFNLVPGE 76 Query: 81 RNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRKAQGL 140 I + Q + ++V DN+ L R + + + R+ ++LE++D+ ++A + L Sbjct: 77 PFIKYLAQDFDLMPYISVADNIGKHLSRRFMQQRE--ERINELLEVVDMTAFADVHVKLL 134 Query: 141 TADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHD 200 + QKQ+++L R + + + +L DEP + ID + LR L K+ T + THD Sbjct: 135 SGGQKQRVALARAIAK-EPELLLLDEPFSHIDNFRRNALRRNLYAYLKKENITCITATHD 193 Query: 201 QTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIG 242 EAL+F++++ +M +GQ +Q TP LF+ P + +V F G Sbjct: 194 SEEALSFSDEIKMMREGQFIQTATPEALFKNPKNAYVASFFG 235 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 308 Length adjustment: 28 Effective length of query: 328 Effective length of database: 280 Effective search space: 91840 Effective search space used: 91840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory