Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate WP_009779625.1 MED217_RS06150 dehydrogenase
Query= metacyc::MONOMER-11683 (330 letters) >NCBI__GCF_000152985.1:WP_009779625.1 Length = 666 Score = 169 bits (427), Expect = 2e-46 Identities = 110/306 (35%), Positives = 172/306 (56%), Gaps = 14/306 (4%) Query: 11 LTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFVISCQGQEAAQVGAAFALDREMDYVL 70 L+ + + +Y+ +L R+I+E+M +L R GKI S GQEA VG AL+ + +Y+L Sbjct: 16 LSHETLLSLYQELLKPRRIEEKMLILLRQGKISKWFSGIGQEAIAVGVTMALETD-EYIL 74 Query: 71 PYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGGRQMPGHFGQKKNRIVTGSSPVTTQVP 130 P +R++GV + L KA + + GR HFG + +IV S + Q+ Sbjct: 75 PMHRNLGVFTTRKVPLHRLFSQWQGKA-NGFTKGRDRSFHFGTQDYKIVGMISHLGPQLG 133 Query: 131 HAVGIALAGRM--EKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAIS 188 A GIALA ++ EKK A F GEG +++GDFHE N A+V LPV+F ENN Y +S Sbjct: 134 VADGIALAHKLRHEKKITAVFT--GEGGTSEGDFHEALNVASVWDLPVLFCIENNGYGLS 191 Query: 189 VPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYR 248 P +Q C +++DRA GYGM ++GN+ +EVYQA+ + E R P L+E ++R Sbjct: 192 TPTSEQYRCAHLADRAKGYGMESHIIDGNNIVEVYQALSKIAESMRENPRPVLVEFKTFR 251 Query: 249 LTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSD----EIEQTMLDEI--- 301 + H + Y E ++ + DP+ ++ YL G+L++ EI +T+ +EI Sbjct: 252 MRGH-EEASGVKYVPEELMQFWAEKDPVSNFEKYLIHQGILTEAQKLEINETIQNEIEYA 310 Query: 302 MAIVNE 307 +++VNE Sbjct: 311 LSLVNE 316 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 666 Length adjustment: 33 Effective length of query: 297 Effective length of database: 633 Effective search space: 188001 Effective search space used: 188001 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory