Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_009780612.1 MED217_RS11085 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000152985.1:WP_009780612.1 Length = 220 Score = 103 bits (257), Expect = 3e-27 Identities = 74/241 (30%), Positives = 124/241 (51%), Gaps = 33/241 (13%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVI-----------TG 57 ++K I K +G +Q L V + IK G+V ++G +GAGKTT ++ T Sbjct: 1 MIKAENIYKSYGDVQVLKGVDLEIKDGEVVSVVGASGAGKTTLLQILGTLDYADKNKATN 60 Query: 58 LYTPDAGTFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGL 117 L+ D +L K + + I FQ +L E TALENV + +I Sbjct: 61 LFINDTQIADLNEKE-----LSKFRNLNIGFIFQFHQLLPEFTALENVCIPAYIAK---- 111 Query: 118 FGAVFRTKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQ 177 K++E A AK A+ELLD++G+G ++K LS G+Q+R+ +AR+L +P Sbjct: 112 ----------KSKEEAEAK-AKELLDFLGLGHRINHKPGALSGGEQQRVAVARSLINEPA 160 Query: 178 LIALDEPAAGMNATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQI 236 LI DEP+ +++ L +L ++R+ N+T +++ H+ L ++T++D GK I Sbjct: 161 LILADEPSGNLDSESAENLHQLFFKLRDTYNQTFVIVTHNEDLATMADRKLTMID-GKII 219 Query: 237 A 237 + Sbjct: 220 S 220 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 220 Length adjustment: 23 Effective length of query: 237 Effective length of database: 197 Effective search space: 46689 Effective search space used: 46689 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory