Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_009778630.1 MED217_RS01145 acyl-CoA dehydrogenase
Query= reanno::ANA3:7024494 (389 letters) >NCBI__GCF_000152985.1:WP_009778630.1 Length = 392 Score = 231 bits (589), Expect = 3e-65 Identities = 135/380 (35%), Positives = 214/380 (56%), Gaps = 5/380 (1%) Query: 5 YTSLNFGLGEEVDMLRDAVQDFAKHEIAPIAAKVDHDNAFPNEIWPVLGGMGLLGVTVPE 64 Y +L+ L EE ++R A +D+ K +++PI + FP EI L +G G +PE Sbjct: 11 YYNLDDLLTEEHKLVRSAARDWVKRDVSPIIEEAAQKAEFPKEIIKGLAEIGAFGPYIPE 70 Query: 65 EYGGANMGYLAHVVAMEEISRASASIGLSYGAHSNLCVNQINRNGNAEQKAKYLPKLVSG 124 EYGGA + +++ + M+EI R + + + S+L + I + G Q+ KYLPKL SG Sbjct: 71 EYGGAGLDQISYGLIMQEIERGDSGVRSTASVQSSLVMYPIFKFGTEVQRKKYLPKLASG 130 Query: 125 EHIGALAMSEPNAGSDVVSMKLHARKEGDRYILNGNKMWITNGPDANTYVIYAKTDLTKG 184 E +G ++EP+ GS+ M + + +GD Y+LNG KMWI+N P A+ V++AK D + Sbjct: 131 EFMGCFGLTEPDHGSNPGGMVTNFKDKGDHYLLNGAKMWISNAPFADIAVVWAK-DESGR 189 Query: 185 AHGITAFIVERGFKGFSQAQKLDKLGMRGSNTCELVFEDVEVPEENILGGLNNGVKVLMS 244 HG+ IVERG +GFS +K +R S T EL+F++V++P+EN+L +G+ + Sbjct: 190 IHGL---IVERGMEGFSTPTTHNKWSLRASATGELIFDNVKIPKENLLPN-KSGLGAPLM 245 Query: 245 GLDYERVVLSGGPLGIMNACMDIVVPYIHEREQFGKSIGEFQLVQGKLADMYTGMNAAKA 304 LD R ++ G +G C D + Y EREQFGK IG FQL Q KLA+M T + A+ Sbjct: 246 CLDSARFGIAWGAIGAAMDCYDTALRYAKEREQFGKPIGSFQLQQKKLAEMITEITKAQL 305 Query: 305 YVYSVAKSCDRGETTRKDAAGAILYSAELATKMALDAIQLLGGNGYVNEYATGRLLRDAK 364 + + + + T + A + E+A K+A +A Q+LGG G EY+ R + + + Sbjct: 306 LAWRLGALRNEDKATSAQISMAKRNNVEMALKIAREARQILGGMGITGEYSIMRHMMNLE 365 Query: 365 LYEIGAGTSEIRRMLIGREL 384 GT +I ++ G ++ Sbjct: 366 SVVTYEGTHDIHLLITGMDI 385 Lambda K H 0.316 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 392 Length adjustment: 31 Effective length of query: 358 Effective length of database: 361 Effective search space: 129238 Effective search space used: 129238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory