Align butyryl-CoA dehydrogenase; EC 1.3.99.2 (characterized)
to candidate WP_009781542.1 MED217_RS15750 acyl-CoA dehydrogenase
Query= CharProtDB::CH_091785 (379 letters) >NCBI__GCF_000152985.1:WP_009781542.1 Length = 380 Score = 404 bits (1039), Expect = e-117 Identities = 203/374 (54%), Positives = 272/374 (72%) Query: 1 MDFNLTREQELVRQMVREFAENEVKPIAAEIDETERFPMENVKKMGQYGMMGIPFSKEYG 60 MDF+L+ E ++R REFA+NE+ P E DE + FP E +KKMG G +G+ E+G Sbjct: 1 MDFSLSEEHIMIRDAAREFAQNELLPGVIERDEKQHFPKELIKKMGDMGFLGMMAPTEFG 60 Query: 61 GAGGDVLSYIIAVEELSKVCGTTGVILSAHTSLCASLINEHGTEEQKQKYLVPLAKGEKI 120 G G D +SY++ +EELSK+ + VI+S + SL + +G++ QK+KYL L GEK+ Sbjct: 61 GGGMDTISYVLVMEELSKIDASASVIVSVNNSLVNYGLATYGSQAQKEKYLSKLTTGEKL 120 Query: 121 GAYGLTEPNAGTDSGAQQTVAVLEGDHYVINGSKIFITNGGVADTFVIFAMTDRTKGTKG 180 GA+ L+EP AG+D+ +Q+T A+ +GDHY++NG+K +ITNGG AD +++ A TD+ K +G Sbjct: 121 GAFCLSEPEAGSDATSQKTTAIDQGDHYILNGTKNWITNGGSADYYLVIAQTDKEKKHRG 180 Query: 181 ISAFIIEKGFKGFSIGKVEQKLGIRASSTTELVFEDMIVPVENMIGKEGKGFPIAMKTLD 240 I+AFI+EKG++GF IG EQKLGIR S T L+F D+ VP EN IG++G GF AMKTL Sbjct: 181 INAFIVEKGWEGFEIGPKEQKLGIRGSDTHSLIFNDVKVPKENRIGEDGFGFKFAMKTLS 240 Query: 241 GGRIGIAAQALGIAEGAFNEARAYMKERKQFGRSLDKFQGLAWMMADMDVAIESARYLVY 300 GGRIGIAAQALGIA GAF AR Y K RK FG + Q +A+ +ADM V IE+AR++V Sbjct: 241 GGRIGIAAQALGIAAGAFELARDYSKVRKAFGTEICNHQAIAFKLADMQVEIEAARHMVM 300 Query: 301 KAAYLKQAGLPYTVDAARAKLHAANVAMDVTTKAVQLFGGYGYTKDYPVERMMRDAKITE 360 KAA+ K G Y + +A AKLHA+ VAMDVT +AVQ+ GG G+ K+Y VER+MRDAKIT+ Sbjct: 301 KAAWDKDQGNNYDISSAMAKLHASKVAMDVTVEAVQVHGGNGFVKEYHVERLMRDAKITQ 360 Query: 361 IYEGTSEVQKLVIS 374 IYEGTSE+QK+VIS Sbjct: 361 IYEGTSEIQKIVIS 374 Lambda K H 0.317 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 380 Length adjustment: 30 Effective length of query: 349 Effective length of database: 350 Effective search space: 122150 Effective search space used: 122150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory