Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate WP_009780191.1 MED217_RS08975 NAD(P)-dependent alcohol dehydrogenase
Query= BRENDA::Q38707 (365 letters) >NCBI__GCF_000152985.1:WP_009780191.1 Length = 349 Score = 325 bits (834), Expect = 9e-94 Identities = 166/345 (48%), Positives = 232/345 (67%), Gaps = 6/345 (1%) Query: 11 VKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVP 70 VKA+G A D L RR +DV++K+ +CGVCHSD H + N+WG + YP+VP Sbjct: 4 VKAYG--AADPKADLKQINIERREVTPRDVKIKITYCGVCHSDIHTVRNDWGGSKYPVVP 61 Query: 71 GHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCEN-TIDTY-GSIY 128 GHEI+G V EVGS+V KVGD VG+GC+V SCR CE C + E CE + TY G Sbjct: 62 GHEIIGKVLEVGSEVSDFKVGDTVGVGCMVDSCRECEPCKHDLEQFCEQGMVGTYNGKDK 121 Query: 129 FDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIG 188 G T+GGYS+ ++ D++++L P+NL ++ APLLCAGITT+SPL ++ + K G K+G Sbjct: 122 HLGGHTYGGYSEEIIVDKYYVLSVPENLDENAVAPLLCAGITTFSPLNHWKVGK-GDKVG 180 Query: 189 VVGLGGLGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGARSSL 248 V+GLGGLGH+ +K A A GA V +I S K ++A ++LGAD L++ D+E MK +S Sbjct: 181 VIGLGGLGHMGIKFAHAMGAHVVMITTSPGKAEDA-KRLGADEVLISKDEEAMKKHANSF 239 Query: 249 DGIIDTVPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGGIKE 308 D +++TVPV H + P LLK + + MVGA E + SL+ GRK + G++ GGIKE Sbjct: 240 DFLLNTVPVGHDINPYLSLLKIDATMCMVGAVEPLEPVHGGSLIMGRKNVAGSLIGGIKE 299 Query: 309 TQEMLDFAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVIDI 353 TQEMLDF +HNI +D+E+I ++ +N A +R+V DV+YRFVID+ Sbjct: 300 TQEMLDFCGEHNIVSDIEMIDINTINDAYDRVVNGDVKYRFVIDM 344 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 349 Length adjustment: 29 Effective length of query: 336 Effective length of database: 320 Effective search space: 107520 Effective search space used: 107520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory