Align Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_009779357.1 MED217_RS04810 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q02635 (400 letters) >NCBI__GCF_000152985.1:WP_009779357.1 Length = 398 Score = 368 bits (945), Expect = e-106 Identities = 191/391 (48%), Positives = 258/391 (65%), Gaps = 3/391 (0%) Query: 4 LADALSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRGETK 63 L+D ++ + SAT+A++ KAREL+A+G+D+IGL GEPDF+TPD IK AAI A++ Sbjct: 8 LSDRINNLAASATLAMAAKARELRAEGKDIIGLSLGEPDFNTPDFIKDAAIQAVNDNYNS 67 Query: 64 YTPVSGIPELREAIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVIPAP 123 YTPV G EL++AI KFKR+NNL Y +Q +V TG KQ L+N LNPGDEV++P P Sbjct: 68 YTPVDGYVELKDAIITKFKRDNNLTYDRSQIVVSTGAKQSLYNVAQVCLNPGDEVLLPCP 127 Query: 124 YWVSYPEMVALCGGTPVFVPTRQENNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAAYSH 183 YWVSY ++V L G PV V T + +FK+ E L+ AITPKTK ++SP NPSG+ YS Sbjct: 128 YWVSYSDIVKLAEGVPVEVETSLDTDFKMTPEQLEAAITPKTKMLWYSSPCNPSGSIYSE 187 Query: 184 EELKALTDVLMKHPHVWVLTDDMYEHLTYGDFRFATPVEVEPGLYERTLTMNGVSKAYAM 243 EL+AL DVL KHP + V++D++YEH+ Y A+ + E +Y+R +T+NGV+KA+AM Sbjct: 188 AELRALADVLQKHPQIVVVSDEIYEHINYVG-GHASMAQFE-DMYDRVVTVNGVAKAFAM 245 Query: 244 TGWRIGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFIGRNKEIFQGRRD 303 TGWRIGY P ++ +A + IQGQ TSGA IAQ A + AL P I + F+ RR Sbjct: 246 TGWRIGYIGAPAYIARACNKIQGQVTSGANCIAQRAVITALEAPVSKIQYMVDEFKERRK 305 Query: 304 LVVSMLNQAKGISCPTPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGVAVV 363 L++ +LN +G C PEGAFYV+P+ + GKT +G I DF +LE VA V Sbjct: 306 LILGLLNDIEGFECNEPEGAFYVFPNISHYFGKTL-NGTTINNASDFALYILEQANVATV 364 Query: 364 HGSAFGLGPNFRISYATSEALLEEACRRIQR 394 G AFG RISYA S+ ++EA RI++ Sbjct: 365 TGEAFGNPNCIRISYAASQDQIKEALARIKK 395 Lambda K H 0.318 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 398 Length adjustment: 31 Effective length of query: 369 Effective length of database: 367 Effective search space: 135423 Effective search space used: 135423 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory