Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate WP_008203190.1 ALPR1_RS19255 long-chain fatty acid--CoA ligase
Query= SwissProt::Q8GQN9 (527 letters) >NCBI__GCF_000166275.1:WP_008203190.1 Length = 513 Score = 203 bits (517), Expect = 1e-56 Identities = 153/496 (30%), Positives = 242/496 (48%), Gaps = 34/496 (6%) Query: 51 TYDELALRVNRCGSALRTTLGLQPKDRVLVCVLDGIDFPTTFLGAIKGGVVPIAINTLLT 110 T+ ++ N+ ++++ LG++ DRV + L+ FP + G +K G + + ++ LL Sbjct: 29 TFAQINGAANQIANSIQK-LGIKKGDRVALSCLNLPYFPMVYFGILKAGAIVVPLSVLLK 87 Query: 111 ESDYEYMLTDSAARVAVVSQELLPLFAPMLG-----KVPTLEHLVVAGGAGED------- 158 + EY L +S A+ + L G E +V D Sbjct: 88 HDEIEYHLQNSGAKAYFCFEGTPDLPMAKEGYEGFCNTDCCEQFIVISPQMSDPSPIDGV 147 Query: 159 -SLAALLATGSEQFEAAPTRPDDHCFWLYSSGSTGAPKGTVHIHSDLIHTAELYARPILG 217 +L L+ F T+ DD +Y+SG+TG PKG HS+L+ A L + IL Sbjct: 148 KALGMLMKDEPPVFSTVVTKSDDTALIIYTSGTTGKPKGAELSHSNLLLNAMLSVK-ILS 206 Query: 218 IREGDVVFSAAKLFFAYGLGNGLIFPLAVGATAVLMAERPTPAAVFERLRRHQPDIFYGV 277 + + D LF + + + L VGAT+VL+ R + VF +++HQ +IF GV Sbjct: 207 LEKEDTQLIVLPLFHIFAMTVLMNAGLYVGATSVLLP-RFDASQVFGLMQKHQVNIFAGV 265 Query: 278 PTLYASMLANPDCPKEGEL--------RLRACTSAGEALPEDVGRRWQARFGVDILDGIG 329 PT+Y +L EGE L+ C S G ALP +V ++ +F VDIL+G G Sbjct: 266 PTMYWGLLNF-----EGEQFDLKGIAKNLKTCVSGGAALPVNVLENFKKKFNVDILEGYG 320 Query: 330 STEMLHIFLSNRAG-DVHYGTSGKPVPGYRLRLIDEDGAEITTAGVAGELQISGPSSAVM 388 +E + N+ G+ G P+ G ++++DE+G E+ G GEL G + Sbjct: 321 MSEGSPVVTFNQKEFGTKAGSVGVPIWGVEVKIVDEEGKELPV-GEKGELIYRGHNVMKG 379 Query: 389 YWNNPEKTAATFMGEWTRSGDKYLVNDEGYYVYAGRSDDMLKVSGIYVSPIEVESALIAH 448 Y+NN E + T W SGD + +++G++ R+ DM+ G+ V P E+E ++ H Sbjct: 380 YYNNLEASEKTIQDGWLYSGDVAIKDEDGFFFIVDRTKDMIIRKGLNVYPREIEEVMMKH 439 Query: 449 EAVLEAAVVGWEDEDHLIKPKAFIVLKPGYGAGEALRTDLKAHVKNLLAPYKYPRWIEFV 508 EAV AV+G E + KA +V G+ E +L + K +A YKYPR IEF+ Sbjct: 440 EAVSMVAVIGVPAESLGEEIKACVVRNNGFDISE---EELISWTKAHIASYKYPRIIEFL 496 Query: 509 DDLPKTATGKIQRFKL 524 D LP +ATGKI + +L Sbjct: 497 DALPMSATGKILKKEL 512 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 513 Length adjustment: 35 Effective length of query: 492 Effective length of database: 478 Effective search space: 235176 Effective search space used: 235176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory