Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate WP_008200408.1 ALPR1_RS10080 AMP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >NCBI__GCF_000166275.1:WP_008200408.1 Length = 492 Score = 143 bits (361), Expect = 1e-38 Identities = 134/531 (25%), Positives = 224/531 (42%), Gaps = 63/531 (11%) Query: 43 PEREALVSVHQGRRYTYAQLQTEAHRLASALLGMGLTPGDR-VGIWSHNNAEWVLMQLAT 101 P++ A+V QG+ YTY L ++ +AS LLG + V ++V Q Sbjct: 12 PKKVAIVD--QGKEYTYQDLSNSSNAVASMLLGDKSDLNESPVAFMVSPGFDYVATQWGI 69 Query: 102 AQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEWQGQQPGH 161 + G + V + Y ++Y + ++V +Y +L E + Sbjct: 70 WRAGGIAVPLCITYPLPSLQYVIEDTQASIIVV-----GEEYQNILNEYQKD-------- 116 Query: 162 LQAAKLPQLKTVVWIDDEAGQGADEPGLLRFTELIARGNAADPRLAQVAAGLQATDPINI 221 P+ K D + +F+ + R P I Sbjct: 117 ------PKFKFFNVSDSK-----------QFSRSFTLPEISKDR------------PAMI 147 Query: 222 QFTSGTTGFPKGATLTHRNILNNGFFIGECMKLTPADRLCIPVPLYHCFGMVLGNLACFT 281 +TSGTT PKG TH NI + + + + + D + +PL+H G++ Sbjct: 148 LYTSGTTSLPKGVLTTHANIESQISTLVKAWEWSSDDYILEILPLHHVHGIINVLCCALW 207 Query: 282 HGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIA------ELDHPRFAEFN--LST 333 GAT+ + N F V + + VPT++ +L E + +S Sbjct: 208 SGATVEFLNQ-FSAKEVFKIFLKGKLNVFMAVPTIYFKLISEWEKLSEEEQKELHQAMSN 266 Query: 334 LRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVSTVGQV 393 R I + P VM++ E ++ + YGMTE + S +R +GQ Sbjct: 267 FRLMISGSAALPVSVMEKWKE-ISGHYLLERYGMTE---IGMAVSNPYHGERRAGHIGQP 322 Query: 394 QPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLAT 453 P + ++ VD + G V G GE KG SV YWG T ++ E GW TGD+A Sbjct: 323 LPGVLLRTVDEE-GQPVNAGDPGEIQIKGPSVFKEYWGKPEATAKSFTEDGWFKTGDIAV 381 Query: 454 MDAEGYVNIVGRIK-DMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAW 512 ++ + Y I+GR D++ GG I EIEE L +H +++D VVG+PD+++GE + A Sbjct: 382 LE-DNYYRILGRDSIDIIKSGGYKISALEIEEVLRKHTEIKDCGVVGIPDEEWGELVVAA 440 Query: 513 IIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIR 563 ++A E + ++ + ++ YK PR F+ P V GK+ K +++ Sbjct: 441 LVADKEFDTKE--LNSWIRERMPSYKTPRKYIFIPDLPRNVMGKVTKNELK 489 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 595 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 492 Length adjustment: 35 Effective length of query: 543 Effective length of database: 457 Effective search space: 248151 Effective search space used: 248151 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory