Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_008203176.1 ALPR1_RS19205 acyl-CoA dehydrogenase
Query= reanno::ANA3:7024494 (389 letters) >NCBI__GCF_000166275.1:WP_008203176.1 Length = 379 Score = 301 bits (770), Expect = 3e-86 Identities = 158/377 (41%), Positives = 229/377 (60%) Query: 8 LNFGLGEEVDMLRDAVQDFAKHEIAPIAAKVDHDNAFPNEIWPVLGGMGLLGVTVPEEYG 67 +NF E M+ D ++DF EI P + D FP +++ LG +GL+GV VP ++G Sbjct: 1 MNFNESENQRMIADMIRDFGAKEITPFRKEWDDTQFFPKDLFKKLGELGLMGVLVPTDFG 60 Query: 68 GANMGYLAHVVAMEEISRASASIGLSYGAHSNLCVNQINRNGNAEQKAKYLPKLVSGEHI 127 GA GY +V A+ E+++ SIGLS AH++LC I G+ EQK KYLPKL + E + Sbjct: 61 GAGFGYDEYVTAIVEVTKLDPSIGLSLAAHNSLCTGHILLFGSEEQKQKYLPKLATCELL 120 Query: 128 GALAMSEPNAGSDVVSMKLHARKEGDRYILNGNKMWITNGPDANTYVIYAKTDLTKGAHG 187 GA ++EPN GSD +MK A K+GD +ILNG K +IT+G + V+ A+T +HG Sbjct: 121 GAWGLTEPNTGSDAGNMKTVAVKDGDYWILNGAKNFITHGVSGDLAVVIARTGEVGDSHG 180 Query: 188 ITAFIVERGFKGFSQAQKLDKLGMRGSNTCELVFEDVEVPEENILGGLNNGVKVLMSGLD 247 +TAFIVERG GF +K DKLGMR S T E++FED ++ E +LG + +G M LD Sbjct: 181 MTAFIVERGTPGFKGGRKEDKLGMRASETAEMIFEDCKIHESQVLGNVGDGFIQSMKVLD 240 Query: 248 YERVVLSGGPLGIMNACMDIVVPYIHEREQFGKSIGEFQLVQGKLADMYTGMNAAKAYVY 307 R+ ++ LGI ++ + Y EREQFGK I FQ + KLADM T + AAK + Sbjct: 241 GGRISIAALSLGIAEGALEASIQYSKEREQFGKPISRFQGISFKLADMATQVEAAKLLIM 300 Query: 308 SVAKSCDRGETTRKDAAGAILYSAELATKMALDAIQLLGGNGYVNEYATGRLLRDAKLYE 367 + +RGE +A A Y++E+ ++ +A+Q+ GG G+ +Y + RD+KL Sbjct: 301 KASDMKNRGEKVTLASAQAKYYASEVCVSVSNEAVQIFGGYGFTKDYPVEKYYRDSKLCT 360 Query: 368 IGAGTSEIRRMLIGREL 384 IG GTSEI++++I RE+ Sbjct: 361 IGEGTSEIQKLVIAREV 377 Lambda K H 0.316 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 379 Length adjustment: 30 Effective length of query: 359 Effective length of database: 349 Effective search space: 125291 Effective search space used: 125291 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory