Align butyryl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_008197806.1 ALPR1_RS01080 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-13470 (379 letters) >NCBI__GCF_000166275.1:WP_008197806.1 Length = 594 Score = 254 bits (650), Expect = 3e-72 Identities = 147/397 (37%), Positives = 228/397 (57%), Gaps = 27/397 (6%) Query: 6 TNEQKFVEQMVSEFTENEVKPIAAEIDETERFPL--ETVEKFAKYGMMGMPFPVEYGGSG 63 T EQK + Q +F + E+ P EID + L +K + G++G+ P EYGG G Sbjct: 27 TEEQKMMAQACQDFIDTEITPKIEEIDSMKNPDLVPSIFKKAGELGLLGISVPEEYGGMG 86 Query: 64 TDYLSYIIAVEGLAKSCTSSSTILSAHTSLCAAPIYDWGTEEQKQKYLVPLAKGEKLGAF 123 ++++ ++ + + S S ST AHT + PI +G+EEQKQKYL LA GE + Sbjct: 87 MNFVTSMLIAD-IIGSAGSFSTTYGAHTGIGTLPILYYGSEEQKQKYLPKLATGEWAACY 145 Query: 124 GLTEPNAGTDAAGQQTTAVL--EGDHYVLNGQKIFITNGAYADTFVIFAMTDRSKGTRGI 181 LTEP+AG+DA +T A L +G HY++NGQK++I+N +AD F++FA + K + Sbjct: 146 CLTEPDAGSDANSGKTKATLTEDGKHYLINGQKMWISNAGFADLFIVFAKIEEDKN---L 202 Query: 182 TAFIVEKDFPGFSIGKSEDKLGIRASSTTELIFENCIVPKENMLGKEGKGFTVAMHTLDG 241 TAFIVEK F G ++ + E K+GI+ SST ++ F +C VP ENML GF +A++ L+ Sbjct: 203 TAFIVEKSFGGITMNEEEKKMGIKGSSTRQVFFNDCKVPVENMLSDRQNGFKIAVNILNI 262 Query: 242 GRIGIAAQALGLAEGALAEALNYMKERKQFGKALYKFQGLAWMVAELDTKIEAVKQLVYK 301 GRI + + LG +A+NY ERKQFG ++ F + M+AE+ + + L Y+ Sbjct: 263 GRIKLGSGILGGVRTVTTKAINYSTERKQFGVSINSFGAVKSMLAEMAIRTYVSESLCYR 322 Query: 302 AA--VNKQM------GLP-----------YSVEAARAKLAAATVAMETTTKVVQIFGGYG 342 A + Q+ G+P +++E A AK+ + V + VQI+GG G Sbjct: 323 AGQDIEDQINEFITDGMPENEAKLKGVEMFAMECAIAKIHGSEVLDYVVDQGVQIYGGMG 382 Query: 343 FTKDYPVERMMRDAKITEIYEGTSQVQKMVISANLFK 379 ++ + P+ER RDA+I IYEGT+++ +M++ L K Sbjct: 383 YSAEAPMERAYRDARIARIYEGTNEINRMLMIGMLLK 419 Lambda K H 0.316 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 594 Length adjustment: 33 Effective length of query: 346 Effective length of database: 561 Effective search space: 194106 Effective search space used: 194106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory