Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (subunit 1/2) (EC 1.3.8.1) (characterized)
to candidate WP_008203176.1 ALPR1_RS19205 acyl-CoA dehydrogenase
Query= BRENDA::D2RL84 (383 letters) >NCBI__GCF_000166275.1:WP_008203176.1 Length = 379 Score = 369 bits (948), Expect = e-107 Identities = 182/379 (48%), Positives = 267/379 (70%) Query: 1 MDFNLTEDQQMIKDMAAEFAEKFLAPTVEERDKAHIWDRKLIDKMGEAGFCGICFPEEYG 60 M+FN +E+Q+MI DM +F K + P +E D + + L K+GE G G+ P ++G Sbjct: 1 MNFNESENQRMIADMIRDFGAKEITPFRKEWDDTQFFPKDLFKKLGELGLMGVLVPTDFG 60 Query: 61 GMGLDVLSYILAVEELSKVDDGTGITLSANVSLCATPIYMFGTEEQKQKYLAPIAEGTHV 120 G G Y+ A+ E++K+D G++L+A+ SLC I +FG+EEQKQKYL +A + Sbjct: 61 GAGFGYDEYVTAIVEVTKLDPSIGLSLAAHNSLCTGHILLFGSEEQKQKYLPKLATCELL 120 Query: 121 GAFGLTEPSAGTDASAQQTTAVLKGDKYILNGSKIFITNGKEADTYVVFAMTDKSQGVHG 180 GA+GLTEP+ G+DA +T AV GD +ILNG+K FIT+G D VV A T + HG Sbjct: 121 GAWGLTEPNTGSDAGNMKTVAVKDGDYWILNGAKNFITHGVSGDLAVVIARTGEVGDSHG 180 Query: 181 ISAFILEKGMPGFRFGKIEDKMGGHTSITAELIFEDCEVPKENLLGKEGEGFKIAMETLD 240 ++AFI+E+G PGF+ G+ EDK+G S TAE+IFEDC++ + +LG G+GF +M+ LD Sbjct: 181 MTAFIVERGTPGFKGGRKEDKLGMRASETAEMIFEDCKIHESQVLGNVGDGFIQSMKVLD 240 Query: 241 GGRIGVAAQALGIAEGALAAAVKYSKEREQFGRSISKFQALQFMMADMATKIEAARYLVY 300 GGRI +AA +LGIAEGAL A+++YSKEREQFG+ IS+FQ + F +ADMAT++EAA+ L+ Sbjct: 241 GGRISIAALSLGIAEGALEASIQYSKEREQFGKPISRFQGISFKLADMATQVEAAKLLIM 300 Query: 301 HAAMLKNEGKPYSEAAAMAKCFASDVAMEVTTDAVQIFGGYGYTVDYPAERYMRNAKITQ 360 A+ +KN G+ + A+A AK +AS+V + V+ +AVQIFGGYG+T DYP E+Y R++K+ Sbjct: 301 KASDMKNRGEKVTLASAQAKYYASEVCVSVSNEAVQIFGGYGFTKDYPVEKYYRDSKLCT 360 Query: 361 IYEGTNQVMRIVTSRALLR 379 I EGT+++ ++V +R +L+ Sbjct: 361 IGEGTSEIQKLVIAREVLK 379 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 379 Length adjustment: 30 Effective length of query: 353 Effective length of database: 349 Effective search space: 123197 Effective search space used: 123197 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory