Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_008198326.1 ALPR1_RS03020 triose-phosphate isomerase
Query= SwissProt::Q8XKU1 (248 letters) >NCBI__GCF_000166275.1:WP_008198326.1 Length = 253 Score = 234 bits (597), Expect = 1e-66 Identities = 122/250 (48%), Positives = 159/250 (63%), Gaps = 4/250 (1%) Query: 1 MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVC---PTFVCLDAVKKAVEGTN 57 MR I+AGNWKM+ T DE KL E+ + KD + VV P F + VKK + G Sbjct: 1 MRKKIVAGNWKMNMTFDEGQKLTSEIVNMYKDENVKDVVAILNPPFPHIFPVKKLIGGVE 60 Query: 58 -IKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAF 116 I +GAQN +E GAFTGE++ +++ + ++YVI+GHSERREYF E +E KVK A Sbjct: 61 GISLGAQNCSDKEAGAFTGEVSAKIIASFGVEYVILGHSERREYFQEDNEILATKVKEAL 120 Query: 117 AHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKT 176 A+ L PI CCGE+L+ R GT +K Q+T L L+ E K+ IAYEPIWAIGTGKT Sbjct: 121 ANGLKPIFCCGESLDIRTAGTHEPNVKFQLTQSLFDLSPEDFSKITIAYEPIWAIGTGKT 180 Query: 177 ATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGAS 236 AT+DQA E AA+R +A +G+E+AD I YGGS P E +K D+DG L+GGAS Sbjct: 181 ATADQAQEMHAALRRHIASHYGKEIADNTSILYGGSCNPKNAQEIFSKPDVDGGLIGGAS 240 Query: 237 LVAADFAQIV 246 L + DF I+ Sbjct: 241 LKSRDFVDII 250 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 253 Length adjustment: 24 Effective length of query: 224 Effective length of database: 229 Effective search space: 51296 Effective search space used: 51296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_008198326.1 ALPR1_RS03020 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.37466.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-59 185.8 0.0 6.1e-59 185.6 0.0 1.0 1 NCBI__GCF_000166275.1:WP_008198326.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000166275.1:WP_008198326.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 185.6 0.0 6.1e-59 6.1e-59 1 227 [. 5 243 .. 5 244 .. 0.92 Alignments for each domain: == domain 1 score: 185.6 bits; conditional E-value: 6.1e-59 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagveva..vappfvdldvvkdeve..seiqvaAqnvdavksGaf 69 +v +n+K+n ++ + +++ +++ + +e++ v+ + ppf ++ vk+ + i+++Aqn+ +++Gaf NCBI__GCF_000166275.1:WP_008198326.1 5 IVAGNWKMNMTFDEGQKLTSEIVNMYKDENVKDVVaiLNPPFPHIFPVKKLIGgvEGISLGAQNCSDKEAGAF 77 699*****************9999877776665542268999999999998766558**************** PP TIGR00419 70 tGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvatta 142 tGe+sA++++ +G+++v++gHsErR +++e +e++++kv + + glk++ C ge+l+ r a+++ nv+ + NCBI__GCF_000166275.1:WP_008198326.1 78 TGEVSAKIIASFGVEYVILGHSERREYFQEDNEILATKVKEALANGLKPIFCCGESLDIRTAGTHEPNVKFQL 150 ****************************************************************999998765 PP TIGR00419 143 aaaA.......lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGasvtaaeda 207 + +++ +A+EP+++iGtGk+++ +a+++++ +r h++ ke+a+++++lyG+s + ++++ NCBI__GCF_000166275.1:WP_008198326.1 151 TQSLfdlspedFSKITIAYEPIWAIGTGKTATADQAQEMHAALRRHIAShYGKEIADNTSILYGGSCNPKNAQ 223 555457888999999*********************************9899********************* PP TIGR00419 208 elaaqldvdGvLlasavlka 227 e + ++dvdG L+++a+lk+ NCBI__GCF_000166275.1:WP_008198326.1 224 EIFSKPDVDGGLIGGASLKS 243 ******************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (253 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.46 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory