Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate WP_008201117.1 ALPR1_RS12360 aldo/keto reductase
Query= SwissProt::O32210 (276 letters) >NCBI__GCF_000166275.1:WP_008201117.1 Length = 315 Score = 187 bits (474), Expect = 3e-52 Identities = 114/288 (39%), Positives = 158/288 (54%), Gaps = 35/288 (12%) Query: 13 NGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESG---- 68 NG ++P GLG +K + G E ++V AI++GYR ID AAIY+NE VG GI E+ Sbjct: 8 NGDKLPIIGLGTWKSKPG-EVKQAVYWAIESGYRHIDCAAIYQNENEVGEGIAEAIKAGL 66 Query: 69 VAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWP-------GKDKYKD 121 V REELF+TSK+WN YE A + SL L LDY+DLYLIHWP G + +D Sbjct: 67 VKREELFVTSKLWNNSHKYEDVKPALKTSLADLGLDYVDLYLIHWPISFKRGVGFPETRD 126 Query: 122 ------------TWRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPR 169 TW A++ + K+G + IGVSNF L E++ P +NQVE HP Sbjct: 127 DFYTYLDVPLSQTWEAMQAVKKEGLAKHIGVSNFNQEKLREIISLGGQIPEMNQVEMHPY 186 Query: 170 LTQKELRDYCKGQGIQLEAWSPLMQGQ-----------LLDNEVLTQIAEKHNKSVAQVI 218 L QKEL +C+ +GI + A+SPL LL + V+ IA+KH S+ Q++ Sbjct: 187 LAQKELVRFCREKGILMTAYSPLGSPDSRNESHKNDPVLLKDPVIELIAKKHGASMGQIL 246 Query: 219 LRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDER 266 + W + IPKS+ + RI EN +L Q D+ ++D + D R Sbjct: 247 IAWSTARDIAVIPKSVNQGRIKENLAASKIKLDQNDLMELDDIGVDFR 294 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 315 Length adjustment: 26 Effective length of query: 250 Effective length of database: 289 Effective search space: 72250 Effective search space used: 72250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory