Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate WP_153231848.1 ALPR1_RS01060 carbohydrate-binding protein
Query= reanno::Cola:Echvi_1841 (141 letters) >NCBI__GCF_000166275.1:WP_153231848.1 Length = 925 Score = 90.1 bits (222), Expect = 7e-23 Identities = 38/82 (46%), Positives = 57/82 (69%) Query: 60 GLALVKESDCPSCHMVERKIVGPAYKDVAEKYESTDENIETLAKRVVDGNNGVWGQVPMP 119 G L++ SDC SCH ++ +GP+Y+ VA+KYE+T EN++ L +V++G +GVWG M Sbjct: 641 GKNLIESSDCKSCHQYDKASIGPSYQAVADKYENTAENVKMLVGKVINGGSGVWGDHAMS 700 Query: 120 AHPGLSEDDAKKMVKYILMLKK 141 AHP LSE D +MV YI+ + + Sbjct: 701 AHPQLSESDVTRMVDYIMNMNE 722 Lambda K H 0.309 0.127 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 141 Length of database: 925 Length adjustment: 29 Effective length of query: 112 Effective length of database: 896 Effective search space: 100352 Effective search space used: 100352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory