Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 177 bits (448), Expect = 3e-49 Identities = 93/225 (41%), Positives = 140/225 (62%), Gaps = 3/225 (1%) Query: 30 LKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQGRIVVDGVELTN-DLKQIEAI 88 L ++NLN+++G+ + GPSG+GKST IRC+N LE+ G I +DGVE+T +++ + Sbjct: 21 LDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHGSIEIDGVEMTKLSPTELKEM 80 Query: 89 RREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEEIAMHYLERVRIPEQAHKYPG 148 R++VG++FQHFNL T+ N P+ + + K+ + LE V + + YP Sbjct: 81 RKKVGIIFQHFNLLSSRTVKGNVAF-PLEIAGLDKKTIDNRVKELLELVGLTNKTDSYPS 139 Query: 149 QLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEVLDTMIGL-AEDGMTMLCVTH 207 QLSGGQ+QRV IARAL PK++L DE TSALDPE +L+ + + E G+T++ VTH Sbjct: 140 QLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSILNLLKEINREFGITIVVVTH 199 Query: 208 EMGFARTVANRVIFMDKGEIVEQAAPNDFFDNPQNDRTKLFLSQI 252 EM + + N+V M+KG+IVEQ + F NP+ + FL + Sbjct: 200 EMNVVKQICNKVAVMEKGQIVEQGLLTEIFANPKTKIAQNFLRSL 244 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 343 Length adjustment: 26 Effective length of query: 228 Effective length of database: 317 Effective search space: 72276 Effective search space used: 72276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory