Align phosphate acetyltransferase (EC 2.3.1.8) (characterized)
to candidate WP_083790235.1 CALHY_RS06320 phosphate acetyltransferase
Query= BRENDA::O52593 (332 letters) >NCBI__GCF_000166355.1:WP_083790235.1 Length = 343 Score = 442 bits (1137), Expect = e-129 Identities = 225/329 (68%), Positives = 278/329 (84%), Gaps = 2/329 (0%) Query: 1 MSFLEQIIERAKSDVKTIVLPESTDLRVIKAASMIMKKGIAKVVLIGNEKEIKSLAGDI- 59 M+F++ IIE+AKSD+KTIVLPES + R +KAAS+ +K+ IAK+VLIG E EIK A Sbjct: 12 MAFIDTIIEKAKSDIKTIVLPESYEERNLKAASIALKEKIAKIVLIGKEDEIKKEAAKFG 71 Query: 60 -DLEGVMIEDSLNSEKLEDYANTLYELRKSKGMTIEAARETIKDPLYYGVMMVKKGEADG 118 +++ + D N ++ +++ N YELRK+KG+T+E A++ +KDP+Y+GVM+V KG ADG Sbjct: 72 ANVDDAIFIDPDNFDRFDEFVNEFYELRKNKGVTLEDAKKFMKDPMYFGVMLVYKGLADG 131 Query: 119 MVAGAVNSTANTLRPALQILKTAPGTKLVSSFFVMVVPNCEYGHNGTFVYADCGLVENPD 178 MV+GA++STA+TLRPALQILKTAPG KLVSSFF+MVVPNCEYG NG FVYAD GL NP Sbjct: 132 MVSGAIHSTADTLRPALQILKTAPGVKLVSSFFIMVVPNCEYGENGVFVYADAGLNPNPT 191 Query: 179 ADQLSEIAISASKSFEMLVGAKPQVAMLSYSSYGSAKSELTEKVIKATQLAKEKAPHLAI 238 A++L++IAI+++KSFE LVG P+VAMLSYS+ GSAKSE+ +KV++AT++AKEKAP L I Sbjct: 192 AEELADIAITSAKSFEALVGKTPKVAMLSYSTKGSAKSEMVDKVVEATRIAKEKAPDLLI 251 Query: 239 DGELQVDAAIVPEVAKSKAKGSSVAGKANVLIFPDLDAGNIAYKLTQRLAKAEAYGPITQ 298 DGELQ DAAIVP VAK KA GS VAG+ANVLIFPDLDAGNIAYKLT+RLAKAEAYGPITQ Sbjct: 252 DGELQADAAIVPSVAKLKAPGSPVAGQANVLIFPDLDAGNIAYKLTERLAKAEAYGPITQ 311 Query: 299 GLARPVNDLSRGCSAEDIVGVAAITAVQA 327 G+A+PVNDLSRGC AEDIVGV AITAVQA Sbjct: 312 GMAKPVNDLSRGCKAEDIVGVIAITAVQA 340 Lambda K H 0.313 0.129 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 343 Length adjustment: 28 Effective length of query: 304 Effective length of database: 315 Effective search space: 95760 Effective search space used: 95760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_083790235.1 CALHY_RS06320 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.3682347.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-129 416.7 0.7 3.7e-129 416.5 0.7 1.0 1 NCBI__GCF_000166355.1:WP_083790235.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000166355.1:WP_083790235.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.5 0.7 3.7e-129 3.7e-129 1 304 [] 29 337 .. 29 337 .. 0.98 Alignments for each domain: == domain 1 score: 416.5 bits; conditional E-value: 3.7e-129 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverlyekrk 73 ivlPE+ eer lkAa++ +++kia+ vl+++++e++k +a+++ ++ + + +dpd ++ +++v+++ye+rk NCBI__GCF_000166355.1:WP_083790235.1 29 IVLPESYEERNLKAASIALKEKIAKIVLIGKEDEIKK-EAAKFGANVDDAIFIDPDNFDRFDEFVNEFYELRK 100 8**********************98877777666666.9********************************** PP TIGR00651 74 hkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfimekee... 143 +kGvt++ a+++++D+++++++lv++g adg+vsGa ++ta+tlrpalqi+kt++gvklvss+fim ++ NCBI__GCF_000166355.1:WP_083790235.1 101 NKGVTLEDAKKFMKDPMYFGVMLVYKGLADGMVSGAIHSTADTLRPALQILKTAPGVKLVSSFFIMVVPNcey 173 *******************************************************************999999 PP TIGR00651 144 ...evlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvkilkeke 213 +v+v+aD ++++P+aeeLA+iA++saks+++l ++ pkva+lsystkgs+k+e+v+kv+eA++i+kek+ NCBI__GCF_000166355.1:WP_083790235.1 174 genGVFVYADAGLNPNPTAEELADIAITSAKSFEALVGKTPKVAMLSYSTKGSAKSEMVDKVVEATRIAKEKA 246 999********************************************************************** PP TIGR00651 214 pdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPilqGlakPvnD 286 pdll+dGelq DaA+v++va+ kap s+vag+anv++FPdLdaGni+Yk+ +Rla+aea+GPi qG+akPvnD NCBI__GCF_000166355.1:WP_083790235.1 247 PDLLIDGELQADAAIVPSVAKLKAPGSPVAGQANVLIFPDLDAGNIAYKLTERLAKAEAYGPITQGMAKPVND 319 ************************************************************************* PP TIGR00651 287 LsRGasvedivnvviita 304 LsRG+++ediv v++ita NCBI__GCF_000166355.1:WP_083790235.1 320 LSRGCKAEDIVGVIAITA 337 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 27.14 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory