Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_013402865.1 CALHY_RS04750 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_000166355.1:WP_013402865.1 Length = 370 Score = 335 bits (859), Expect = 1e-96 Identities = 192/377 (50%), Positives = 246/377 (65%), Gaps = 20/377 (5%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 MA + L V K Y G + AV + +LDI+D EF+VLVGPSGCGK+TTLRM+AGLE V Sbjct: 1 MASVRLKGVYKRYP----GGVTAVSDFNLDIEDKEFIVLVGPSGCGKTTTLRMIAGLEEV 56 Query: 61 TEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRV 120 TEGE+ + D+++N V +DRDIAMVFQ+YALYPH +V NM+FGL+ P DEI++RV Sbjct: 57 TEGEIYIGDKLVNDVPPKDRDIAMVFQNYALYPHMTVFENMAFGLKLRK-FPKDEIKRRV 115 Query: 121 EETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRT 180 E +LGI LLDRKP LSGGQ+QRVALGRAIVR+P+VFLMDEPLSNLDAKLR +MRT Sbjct: 116 HEAAKILGIEHLLDRKPKALSGGQRQRVALGRAIVREPKVFLMDEPLSNLDAKLRVQMRT 175 Query: 181 ELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFI 240 EL +L LG T +YVTHDQTEAMTMG R+ V+ DG +QQV TP Y +P NLFVAGFI Sbjct: 176 ELSKLHKRLGTTFIYVTHDQTEAMTMGTRIVVMKDGFIQQVDTPQVLYEQPANLFVAGFI 235 Query: 241 GEPSMNLFDGSLSGD------TFRGDGFDYPLSGATRDQLGGASG--LTLGIRPEDVTVG 292 G P MN + + F + P A + + G G + +GIRPED+ Sbjct: 236 GSPQMNFIESRIEQKDKNLYVVFGNNAIKLPEGKAKKVEELGYVGKEVIMGIRPEDLHDE 295 Query: 293 E---RRSGQRTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVS 349 E + + DA V VVE G+E +++ +G A +S+ +AGD+ ++ Sbjct: 296 EIFLQTAQDAVVDANVDVVEMLGSETLLYVVV----DGLNLIARVDPRSKAKAGDKIKLA 351 Query: 350 FPEDAIHLFDGETGDAL 366 F + IHLFD ET A+ Sbjct: 352 FDVNRIHLFDKETEKAI 368 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 370 Length adjustment: 30 Effective length of query: 353 Effective length of database: 340 Effective search space: 120020 Effective search space used: 120020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory