Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 210 bits (534), Expect = 3e-59 Identities = 108/245 (44%), Positives = 164/245 (66%), Gaps = 7/245 (2%) Query: 1 MIKVEKLSKSFGKHEV----LKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGG 56 MI+++ L+K + + + L N++ I +G++ +IGPSG+GKST +RC+N+LEKP G Sbjct: 1 MIRIKNLTKIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHG 60 Query: 57 TITIKDTEITKPKTNTLK-VRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQE 115 +I I E+TK LK +R+ +G++FQHF+L +TV N+ + P+ + K+ Sbjct: 61 SIEIDGVEMTKLSPTELKEMRKKVGIIFQHFNLLSSRTVKGNVAF-PLEIAGLDKKTIDN 119 Query: 116 KAEDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEV 175 + ++LL VGL K + YP++LSGGQKQRV IARALA NP ++L DE TSALDPE + Sbjct: 120 RVKELLELVGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSI 179 Query: 176 LQVMKEL-VETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQD 234 L ++KE+ E G+T+V+VTHEM K++ ++V M++G IVE G E F +PK+K AQ+ Sbjct: 180 LNLLKEINREFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFANPKTKIAQN 239 Query: 235 FLEKI 239 FL + Sbjct: 240 FLRSL 244 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 343 Length adjustment: 26 Effective length of query: 214 Effective length of database: 317 Effective search space: 67838 Effective search space used: 67838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory