Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_013404258.1 CALHY_RS12265 phosphate ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_000166355.1:WP_013404258.1 Length = 251 Score = 156 bits (394), Expect = 4e-43 Identities = 94/244 (38%), Positives = 141/244 (57%), Gaps = 11/244 (4%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGT---- 57 I+ L+ +G + LKN++ +I E + A+IGPSG GKSTFLR LN + G Sbjct: 5 IETIDLNLFYGNEQALKNVNISIPEKAITALIGPSGCGKSTFLRTLNRMNDLIDGVKIWG 64 Query: 58 -ITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEK 116 + I T+I N +++R+ +GM+FQH + FP ++ EN+ Y P + K+ E Sbjct: 65 KVFIDGTDIYADSINLMELRKKVGMIFQHPNPFP-MSIYENVAYGPRIHGVKDKKKLDEI 123 Query: 117 AEDLLRKVGLFEKRNDYPNR----LSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMV 172 E L + GL+++ D ++ LSGGQ+QR+ IARALA+ P I+L DEPTSALDP Sbjct: 124 VEKCLIRAGLWQEVKDRLSKSALSLSGGQQQRLCIARALAVEPQILLLDEPTSALDPLST 183 Query: 173 KEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRA 232 + +++ EL E T+VIVTH M A ++D F G ++E G + F +PK KR Sbjct: 184 LRIEELLIELKEY-YTIVIVTHNMQQAARISDWTGFFLNGELIEFGRTIDIFHAPKDKRT 242 Query: 233 QDFL 236 D++ Sbjct: 243 DDYI 246 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 251 Length adjustment: 24 Effective length of query: 216 Effective length of database: 227 Effective search space: 49032 Effective search space used: 49032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory