Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_013402768.1 CALHY_RS04225 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000166355.1:WP_013402768.1 Length = 261 Score = 268 bits (684), Expect = 1e-76 Identities = 138/242 (57%), Positives = 174/242 (71%), Gaps = 10/242 (4%) Query: 30 KWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVDGIELTS- 88 K++G VL ++L V+RGE +VI GPSGSGKST +RC+N LE SG I +DG + Sbjct: 20 KYFGHNLVLDKVSLEVNRGEVVVIIGPSGSGKSTFLRCLNHLERINSGYIEIDGFVIEDK 79 Query: 89 ---------DLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAM 139 K I + S++GMVFQ FNLFPH+T LEN+ + P+ V K+ K EA E M Sbjct: 80 GFHEKHKKHSSKEIARFCSQIGMVFQRFNLFPHMTALENVIVGPVVVNKMKKEEAVELGM 139 Query: 140 YYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDT 199 LEKV + ++A YP QLSGGQQQRVAIAR+L MKPK+MLFDEPTSALDPE++ EVL+ Sbjct: 140 ELLEKVGLKDKANSYPAQLSGGQQQRVAIARALAMKPKVMLFDEPTSALDPELVGEVLNV 199 Query: 200 MIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQ 259 M +LAEEGMTML VTHEMGFA+ VA+RV+FM G+IVE+ P + F NP+ ERT+QFL + Sbjct: 200 MKELAEEGMTMLVVTHEMGFAREVADRVVFMDKGKIVEEGLPEEIFTNPKQERTRQFLQK 259 Query: 260 IL 261 IL Sbjct: 260 IL 261 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 261 Length adjustment: 25 Effective length of query: 238 Effective length of database: 236 Effective search space: 56168 Effective search space used: 56168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory