Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 191 bits (484), Expect = 2e-53 Identities = 101/242 (41%), Positives = 157/242 (64%), Gaps = 7/242 (2%) Query: 1 MIELKNVNKYYGTHHV----LKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSG 56 MI +KN+ K Y ++ + L N+NL++++G+ IIGPSG+GKST IRC+N LE+ + G Sbjct: 1 MIRIKNLTKIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHG 60 Query: 57 EVVVNNLVLNHKNKIEI--CRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEE 114 + ++ + + + E+ RK ++FQHFNL TV N+ P+++ KK + Sbjct: 61 SIEIDGVEMTKLSPTELKEMRKKVGIIFQHFNLLSSRTVKGNVAF-PLEIAGLDKKTIDN 119 Query: 115 TAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEV 174 + L++VGL +K + YP+ LSGGQ+QRV IAR+L +L DE TSALDPET + Sbjct: 120 RVKELLELVGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSI 179 Query: 175 LDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARL 234 L+++KEI+ + T+VVVTHEM K++ +++ ME G IVE+ + +E F+NPKT+ A+ Sbjct: 180 LNLLKEINREFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFANPKTKIAQN 239 Query: 235 FL 236 FL Sbjct: 240 FL 241 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 343 Length adjustment: 26 Effective length of query: 216 Effective length of database: 317 Effective search space: 68472 Effective search space used: 68472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory