Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 175 bits (443), Expect = 1e-48 Identities = 97/244 (39%), Positives = 152/244 (62%), Gaps = 9/244 (3%) Query: 1 MISIKNVNKWYG----DFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKG 56 MI IKN+ K Y D + L + + ++KG++ + GPSG+GKSTLI+C+N LE G Sbjct: 1 MIRIKNLTKIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHG 60 Query: 57 DVVVDGTSIAD-PKTDLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATK 115 + +DG + T+L ++R +VG++FQHF L T+ N+ +++ G K+ Sbjct: 61 SIEIDGVEMTKLSPTELKEMRKKVGIIFQHFNLLSSRTVKGNVAFP-LEIAGLDKKTIDN 119 Query: 116 KGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEV 175 + +LLE VGL+ +P QLSGGQ+QRV IARALA +P V+L DE TSALDPE + Sbjct: 120 RVKELLELVGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSI 179 Query: 176 LDVMVQLANE-GMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARSDRA 234 L+++ ++ E G+T++ VTHEM +++ ++V M++G+I+E E F N ++ A Sbjct: 180 LNLLKEINREFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFA--NPKTKIA 237 Query: 235 QHFL 238 Q+FL Sbjct: 238 QNFL 241 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 343 Length adjustment: 26 Effective length of query: 218 Effective length of database: 317 Effective search space: 69106 Effective search space used: 69106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory