Align isocitrate dehydrogenase (NAD+) (EC 1.1.1.41) (characterized)
to candidate WP_013403984.1 CALHY_RS10790 isocitrate/isopropylmalate dehydrogenase family protein
Query= BRENDA::Q945K7 (374 letters) >NCBI__GCF_000166355.1:WP_013403984.1 Length = 335 Score = 346 bits (887), Expect = e-100 Identities = 176/324 (54%), Positives = 230/324 (70%), Gaps = 1/324 (0%) Query: 47 TLFPGDGIGPEIAESVKKVFTTAGVPIEWEEHYVGTEIDPRTQSFLTWESLESVRRNKVG 106 TL PGDGIGPE+ E+ ++V +GV IEWE G + + + L LESV+RNKV Sbjct: 6 TLIPGDGIGPEVTEAARRVLDASGVKIEWEVVEAGEMVMEQYGTPLPDHVLESVKRNKVA 65 Query: 107 LKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYS 166 LKGP+ TP+G G RS+N+ LR+ LNLYANVRP S G +RY +VDLI +RENTE Y+ Sbjct: 66 LKGPITTPVGTGFRSVNVALRQALNLYANVRPVKSYEGVPSRYTNVDLIIVRENTEDLYA 125 Query: 167 GLEHQVVRGVVESLKIITRQASLRVAEYAFLYAKTHGRERVSAIHKANIMQKTDGLFLKC 226 G+E+ +KIITR+AS R+ YAF A+ R +V+A+HKANI + TDGLFL+C Sbjct: 126 GIEYMAGDDAAVGVKIITRKASERIVRYAFELARREKRRKVTAVHKANIQKLTDGLFLEC 185 Query: 227 CREVAEKYPEITYEEVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTP 286 R+VA+ YP+I +E++++D M LV++P +DVLVMPN+YGDI+SDL AGLVGGLG+ P Sbjct: 186 ARKVAQDYPDIEFEDMIVDAMSMKLVQSPENYDVLVMPNMYGDILSDLAAGLVGGLGIAP 245 Query: 287 SCNIGEDGVALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHLKFNEQAEQIHSAIINT 346 NIGEDG A+ E +HGSAP AG+NLANPTA +LSGVMMLR+L E A+++ A+ Sbjct: 246 GANIGEDG-AVFEPIHGSAPKRAGQNLANPTATILSGVMMLRYLGELEAADRVEKAVAKV 304 Query: 347 IAEGKYRTADLGGSSTTTEFTKAI 370 I EGK T DLGGS+ T EF A+ Sbjct: 305 IKEGKEVTYDLGGSTGTKEFADAV 328 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 335 Length adjustment: 29 Effective length of query: 345 Effective length of database: 306 Effective search space: 105570 Effective search space used: 105570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory