Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_013402768.1 CALHY_RS04225 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_000166355.1:WP_013402768.1 Length = 261 Score = 243 bits (620), Expect = 3e-69 Identities = 129/243 (53%), Positives = 176/243 (72%), Gaps = 1/243 (0%) Query: 7 QDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEE 66 +++ K +G + VL VSL+ G+V+ IIG SGSGKSTFLRC+N LE+ ++G I ++ Sbjct: 16 KNIVKYFGHNLVLDKVSLEVNRGEVVVIIGPSGSGKSTFLRCLNHLERINSGYIEIDGFV 75 Query: 67 LKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKTEA 126 ++ + K + K++ R S++ MVFQ FNL+ HMTA+EN++ PV V M K EA Sbjct: 76 IEDKGFHEKHKKHSS-KEIARFCSQIGMVFQRFNLFPHMTALENVIVGPVVVNKMKKEEA 134 Query: 127 REKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELVG 186 E L KVG+ + ++YP +SGG+QQRVAIARALAM+P+VMLFDEPTSALDPELVG Sbjct: 135 VELGMELLEKVGLKDKANSYPAQLSGGQQQRVAIARALAMKPKVMLFDEPTSALDPELVG 194 Query: 187 DVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERLQ 246 +VL VM+ LA+EG TM+VVTHEMGFAREV++++VF+ KG + E G P E+ NP+ ER + Sbjct: 195 EVLNVMKELAEEGMTMLVVTHEMGFAREVADRVVFMDKGKIVEEGLPEEIFTNPKQERTR 254 Query: 247 QFL 249 QFL Sbjct: 255 QFL 257 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 261 Length adjustment: 24 Effective length of query: 230 Effective length of database: 237 Effective search space: 54510 Effective search space used: 54510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory