Align Fructose import permease protein FruG (characterized)
to candidate WP_013402619.1 CALHY_RS03455 ABC transporter permease
Query= SwissProt::Q8G845 (340 letters) >NCBI__GCF_000166355.1:WP_013402619.1 Length = 328 Score = 153 bits (386), Expect = 7e-42 Identities = 90/270 (33%), Positives = 154/270 (57%), Gaps = 11/270 (4%) Query: 64 ILAVAMTLPILTGGIDLSVGAIVAITAVV-GLKLANAGVPAFLVMIIMLLIGAVFGLLAG 122 +LA+ +T I+T GIDLS+G ++ ++AV+ G+ + +P +L ++ + G + G + G Sbjct: 56 MLALGVTFVIITSGIDLSIGTVMTLSAVMSGVFITYWHLPVWLGVLGGIGTGMLCGFVNG 115 Query: 123 TLIEEFNMQPFIATLSTMFLARGLASIISTDSLTF----PQGNDFSFISNVIKIIDNPKI 178 +I + + PFIATL M +A+GLA +IS + + P +D + S + KII I Sbjct: 116 IVISKMKLPPFIATLGMMMIAKGLALVISGATPIYYTDAPSFSDIAMGSIIGKIIPGADI 175 Query: 179 SNDLSFNVGVIIALVVVVFGYVFLHHTRTGRTIYAIGGSRSSAELMGLPVKRTQYIIYLT 238 N ++I ++ + + L T GR +AIG + +A L GL V R + IIY+ Sbjct: 176 PN------AILIFILFAIIANIILTKTAIGRYDFAIGSNEEAARLSGLNVDRWKIIIYML 229 Query: 239 SATLAALASIVYTANIGSAKNTVGVGWELDAVASVVIGGTIITGGFGYVLGSVLGSLVRS 298 + I+ + + SA+ +G G+ELDA+A+VVIGGT ++GG G ++G+V+G+L+ S Sbjct: 230 CGFFVGIGGILMASRLNSAQPALGQGYELDAIAAVVIGGTSLSGGEGSIIGTVIGALIMS 289 Query: 299 ILDPLTSDFGVPAEWTTIVIGLMILVFVVL 328 L VP EW ++ G++++ V L Sbjct: 290 TLTNGLRILSVPQEWQIVISGIIVIGAVYL 319 Lambda K H 0.327 0.142 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 328 Length adjustment: 28 Effective length of query: 312 Effective length of database: 300 Effective search space: 93600 Effective search space used: 93600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory