Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 139 bits (349), Expect = 1e-37 Identities = 81/214 (37%), Positives = 133/214 (62%), Gaps = 11/214 (5%) Query: 7 KKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIGGRK 66 KK + + + V+ I+LE++ EFI ++GPSGCGKST L +IAGLE+ S G + + G++ Sbjct: 10 KKFLSKNKEITVLEKINLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSEGKVFLNGKE 69 Query: 67 VNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDLAHL 126 + L P I M FQ AL+P + V +N+ F +K+ G P +E R +A L + HL Sbjct: 70 I--LSPGPDRIVM-FQESALFPWLKVIDNVEFGMKLRGVPKKE---RYEKALKYLKMVHL 123 Query: 127 LERRPS---QLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARM 183 + + + QLSGG +QRVA+ RA+ +V L DEP + LD++ + + E++++ Sbjct: 124 TKFKDAYVHQLSGGMKQRVALARALTLDSEVMLMDEPFAALDSQTKNILLLELQRIWWET 183 Query: 184 QATMIYVTHDQVEAMTLSDRIVIM--RDGHIEQV 215 + T+I+VTH+ EA+ L+D++V+M G I++V Sbjct: 184 KKTIIFVTHNIEEAVLLADKVVVMSSNPGKIKKV 217 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 279 Length adjustment: 28 Effective length of query: 337 Effective length of database: 251 Effective search space: 84587 Effective search space used: 84587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory