Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 140 bits (352), Expect = 6e-38 Identities = 76/189 (40%), Positives = 115/189 (60%), Gaps = 3/189 (1%) Query: 21 LKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAILVDDADISGMSPKDRDIA 80 L+ I L+I GEF+ ++GPSGCGKSTL+N IAGLE S G + ++ +I P D Sbjct: 22 LEKINLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSEGKVFLNGKEILSPGP---DRI 78 Query: 81 MVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSKLLQIEHLLSRKPGQLSGGQ 140 ++FQ AL+P + V DN+ FG+K+R +P E E+ + K++ + QLSGG Sbjct: 79 VMFQESALFPWLKVIDNVEFGMKLRGVPKKERYEKALKYLKMVHLTKFKDAYVHQLSGGM 138 Query: 141 QQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIEAM 200 +QRVA+ RAL ++ L DEP + LD++ + + E++ + K T ++VTH+ EA+ Sbjct: 139 KQRVALARALTLDSEVMLMDEPFAALDSQTKNILLLELQRIWWETKKTIIFVTHNIEEAV 198 Query: 201 TLGDKVAVM 209 L DKV VM Sbjct: 199 LLADKVVVM 207 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 279 Length adjustment: 28 Effective length of query: 358 Effective length of database: 251 Effective search space: 89858 Effective search space used: 89858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory