Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_013402059.1 CALHY_RS00420 phosphoglucomutase/phosphomannomutase family protein
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000166355.1:WP_013402059.1 Length = 471 Score = 237 bits (604), Expect = 7e-67 Identities = 159/469 (33%), Positives = 233/469 (49%), Gaps = 27/469 (5%) Query: 5 FGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALISG 64 FGT G R I + T E K+ A +K +G +V+G D R + Sbjct: 4 FGTGGWRAIIGDDFTKENIQKVAQAVSIYMKEKGIDSDGIVLGYDRRFLSDKAARWFSEV 63 Query: 65 LLSVGCDVIDVG-IAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNG----MG 119 L + G + + +APTP V + K N GA +TASHNP +YNGIKL G + Sbjct: 64 LSANGIKIFFINKVAPTPLVMFTVKKLNTKFGATVTASHNPADYNGIKLFIEEGRDAPLE 123 Query: 120 LKKEREAIVEELFFKEDFDRAKWYEIGEVRREDIIKP---YIEAIKSKVDVEAIKKRKPF 176 + E EAI L + R K+ + + +II P YI+AI S VD+EAIKKRK Sbjct: 124 VTSEIEAIANSLP-SDSIKRLKFEKAIDNGFIEIIDPFDDYIDAILSMVDIEAIKKRKLR 182 Query: 177 VVVDTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGA 236 +++D G +L +L C V T++ + D F R P P L +V G Sbjct: 183 ILLDPMYGVSRTSLQTILITARCDVDTIHERHDTLFGGRLPSPTTSTLYRLKHLVVEKGY 242 Query: 237 DFGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLKEKG-GGLLVTTVATSNLLDDIA 295 D G+ DGDADR +DE G FI + L+ LK KG G V +AT++LLD IA Sbjct: 243 DLGIGTDGDADRVGIVDEKGNFIHPNDILVLLYYYFLKYKGWKGPAVRNLATTHLLDRIA 302 Query: 296 KKHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAK 355 G K VG ++ + E IGGE +GG+ H+ G+DG +VE+ K Sbjct: 303 SSFGEKCYEVPVGFKYISAKMEETGAIIGGESSGGLTIKGHIKGKDGIFAATLLVELICK 362 Query: 356 SGKKFSELIDELPKYYQIKTKRHVEGDRHAI----VNKVAEMARERGY---------TVD 402 +G+K SE+++E+ + Y + ++E + ++ K+ E+ ++ + V Sbjct: 363 TGRKLSEILEEIQRIYGV---LYMEENDFSLEPEEKEKIWEILFDKKHLPDFPFEISNVS 419 Query: 403 TTDGAKIIFED-GWVLVRASGTEPIIRIFSEAKSKEKAQEYLNLGIELL 450 DG K+ F++ GWVL R SGTEP++RI+SE KE+AQE + E L Sbjct: 420 YIDGVKVYFKNGGWVLARFSGTEPLLRIYSEMDDKEQAQEVCRIFAEFL 468 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 471 Length adjustment: 33 Effective length of query: 422 Effective length of database: 438 Effective search space: 184836 Effective search space used: 184836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory