Align phosphoglucomutase; EC 5.4.2.2 (characterized)
to candidate WP_013402653.1 CALHY_RS03635 phosphoglucomutase/phosphomannomutase family protein
Query= CharProtDB::CH_002452 (546 letters) >NCBI__GCF_000166355.1:WP_013402653.1 Length = 467 Score = 180 bits (457), Expect = 9e-50 Identities = 148/485 (30%), Positives = 233/485 (48%), Gaps = 43/485 (8%) Query: 40 VKFGTSGHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVL 99 + FGT G RG A F ++ +AQAI+E +N VG D SE Sbjct: 4 ITFGTDGWRGVIA-DDFTFENVKVVAQAISEYVLENYENPTIIVGYDYRFHSENFAKVCA 62 Query: 100 EVLAANGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNP 159 EVL++N + V++ + PTPA+++A++ KKG ++ I+IT SHNP GIK+ P Sbjct: 63 EVLSSNAIHVLLSKQP--IPTPALAHAVV---KKG--VSGAIMITASHNPYYYNGIKFIP 115 Query: 160 PNGGPADTNVTKVVEDRANALLADGLKGVKRISLDEAMASGHVKEQDLVQPFVEGLADIV 219 GGPA+T +T + + +GL ++ DE + ++ D + ++ + +++ Sbjct: 116 HYGGPANTQITDKIVKNVERIQKEGLGS---LNPDEKL----IEYFDHKEEYINDVLNLI 168 Query: 220 DMAAIQKAGLTLGVDPLGGSGIEYWKRIGEYYNLNLTIVNDQVDQTFRFMHLDKDGAIRM 279 D A + L + V+P+ G GI Y + + ++N+ D F HL + M Sbjct: 169 DKKAFEGKTLKVLVNPMYGCGIGYVDEALKRLGCEVKVINNWRDPLFGG-HLPEPNLENM 227 Query: 280 DCSSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAG-LMNPNHYLAVAINYLFQHRPQ 338 E + +KFDL A D D DR G+V P G ++ N + + +YL + R Sbjct: 228 KDLLEVIKS------EKFDLGLATDGDADRFGVVNPDGEYISANEVIFMLADYLIKTR-- 279 Query: 339 WGKDVAVGKTLVSSAMIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFL 398 GK ++ +T+ +++M+D++ + +E PVGFK+ + L GGEES G S Sbjct: 280 -GKASSIARTVATTSMLDKIAEKHNMRCIETPVGFKYIAECLMKEDSLIGGEESGGLSI- 337 Query: 399 RFDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNELAKRFGAPSYNRLQAAATSAQK- 457 +KDGI+ LL AE A K+P+E + +G R+ TS +K Sbjct: 338 ----KGHVPEKDGILADLLVAETVAKLQKSPKEILKSIESEYGKLYNKRIDVRTTSQKKE 393 Query: 458 AALSKLSPEMVSASTLAGDPITARLTAAPGNGASIGGLKV-MTDNGWFAARPSGTEDAYK 516 AL ++ + S +AG T T GLKV + D WF RPSGTED + Sbjct: 394 EALERI--KNFGKSEVAGLKCTEYRTR--------DGLKVILEDMSWFLVRPSGTEDLIR 443 Query: 517 IYCES 521 IY ES Sbjct: 444 IYGES 448 Lambda K H 0.316 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 651 Number of extensions: 39 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 546 Length of database: 467 Length adjustment: 34 Effective length of query: 512 Effective length of database: 433 Effective search space: 221696 Effective search space used: 221696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory