Align 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase; 2-dehydro-3-deoxy-galactonate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase; EC 4.1.2.14; EC 4.1.2.51; EC 4.1.2.-; EC 4.1.2.21 (characterized)
to candidate WP_013404051.1 CALHY_RS11140 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::Q6KZI8 (266 letters) >NCBI__GCF_000166355.1:WP_013404051.1 Length = 302 Score = 124 bits (310), Expect = 3e-33 Identities = 92/277 (33%), Positives = 142/277 (51%), Gaps = 30/277 (10%) Query: 1 MITPLDAHGNIDYNATNILIKY-LEGINVDYLFPMGSTGVFPYFTLKERKDFLKFVRE-- 57 ++TP D + I+Y A L++Y +E D + G+TG F T +ERKD KF E Sbjct: 11 VVTPFDENEKINYEAYQQLLEYVIEKNYCDTIVVTGTTGEFNTLTFEERKDLFKFTVEVV 70 Query: 58 NSKKPIMAGVGSSSINEVNELMKFSMDIGIEAAVLMPPYYIKLNQEAIYHYYKEILSSND 117 ++KPI+AG G +S E L + +GI +++ PYY K QE IY +YK ++ + Sbjct: 71 GNRKPIIAGTGCASTRETIALTNEAFKLGISTCMIVAPYYCKPTQEDIYIHYKRVVENTG 130 Query: 118 MDLLIYNIPQFTN-KIDPETVKNLKSEFSSVKGVKDSS----ADIRGFMEMLSLSDDDFA 172 ++L+YNIP FT I+P+TVK L ++ + G+KD + + + + +F Sbjct: 131 AEILLYNIPLFTGVNIEPQTVKKL-AQNKQIIGIKDEAGMNPTQLTEYYYATKDINPEFL 189 Query: 173 VFQGQDDLLFTSLELGASGGVCGTTNF-SDGIVRLYHEY-KNNREMALKIEKNDVIPLMK 230 +F G D +L +L GA G V G + D I +++ EY K N + AL I + Sbjct: 190 LFNGDDLMLMPTLAQGAVGIVSGGAHLVGDKIRKVFEEYEKGNIQEALSI--------YR 241 Query: 231 KLGKYQFPNAYYEYFYKKNNINGGYRP-PMYRVGIEI 266 KL K ++YF +NG P P+ R IEI Sbjct: 242 KLYK------LFKYF----TLNGRVHPNPVLREAIEI 268 Lambda K H 0.319 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 302 Length adjustment: 26 Effective length of query: 240 Effective length of database: 276 Effective search space: 66240 Effective search space used: 66240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory