Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_013403235.1 CALHY_RS06825 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000166355.1:WP_013403235.1 Length = 294 Score = 266 bits (680), Expect = 4e-76 Identities = 142/304 (46%), Positives = 204/304 (67%), Gaps = 14/304 (4%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 M F+QQL+NG+TLGS+Y L+++GYTMVYGII +INFAHGDIFM+G + I +L +T + Sbjct: 1 MSTFIQQLINGITLGSVYALISLGYTMVYGIIKLINFAHGDIFMVGAY---IAYLSVTYL 57 Query: 61 FAGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQ 120 GL + L+V+M+ S+ IE+ AY+PLR S R++ LITAIG+S+ L N +Q Sbjct: 58 KLGL------IPSLIVSMVFCSILGMLIEKFAYKPLRNSPRISALITAIGVSLLLENLMQ 111 Query: 121 VTQGPRNKPIPPMVSS----VYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQ 176 + G ++ P +V+ ++Q I V+ KQI +++IT +L+ I ++V +T +G+A Sbjct: 112 IIMGADSRVFPRLVAEKNYHLFQ-DRIVVNNKQIYLLIITVLLMIILNFVVKKTKIGKAM 170 Query: 177 RATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFT 236 RA QD A L+G+NVD TIS TF +G+ALAA AG + +YY + G PG+KAF Sbjct: 171 RAVSQDMDAARLMGINVDTTISYTFAIGSALAAAAGVLVGLYYNTINPLMGVLPGLKAFI 230 Query: 237 AAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGRPE 296 AAV GGIG +PGA+ GG +G+IE+L S Y + YKD FA+L +LI KP+G+LG+ Sbjct: 231 AAVFGGIGIIPGAMLGGFSLGIIETLVSGYGSSMYKDAVAFALLILILIIKPSGLLGKNI 290 Query: 297 VEKV 300 EKV Sbjct: 291 KEKV 294 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 294 Length adjustment: 26 Effective length of query: 274 Effective length of database: 268 Effective search space: 73432 Effective search space used: 73432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory