Align fumarate hydratase (EC 4.2.1.2); (S)-2-methylmalate dehydratase (EC 4.2.1.34) (characterized)
to candidate WP_013404426.1 CALHY_RS13140 fumarate hydratase
Query= BRENDA::Q141Z6 (520 letters) >NCBI__GCF_000166355.1:WP_013404426.1 Length = 278 Score = 179 bits (455), Expect = 9e-50 Identities = 109/285 (38%), Positives = 160/285 (56%), Gaps = 15/285 (5%) Query: 14 MTVIKQEDLIQSIADSLQYISYYHPLDYIQALGRAYELEQSPAAKDAIAQILTNSRMCAE 73 M ++ E + Q + +++ P D +L +AY E+ AK + ++ N + + Sbjct: 1 MRIVPAEIIEQKVYEAINQAVCILPDDVKDSLHKAYASEEG-IAKYTLENLIKNIDLAQQ 59 Query: 74 GKRPICQDTGIVTVFVKVGMDVRWDGATMGVTDMINEGVRRGYLNPDNVLRASIVSPPEG 133 RP+CQDTG FV++G DV +G+ + D IN V R Y D LR S+V P Sbjct: 60 KMRPVCQDTGAAVFFVEIGEDVFIEGS---LKDAINRAVSRAYT--DFYLRKSMVKSPIE 114 Query: 134 GRKNTKDNTPAVIHYEIVPGNTVDVQVAAKGGGSENKSKFAMLNPSDSIVD---WILKTV 190 R+NT DNTPA+IH ++ G+ + + KG GSENKS ML P+D I ++++TV Sbjct: 115 -RENTLDNTPAIIHIDMAKGDKITIHFMPKGFGSENKSTICMLTPADGIEGIEKFVVETV 173 Query: 191 PTMGAGWCPPGMLGIGIGGTAEKAMVMAKESLMDPIDIQDVIARGPKDWIEELRVELHEK 250 G+ CPP ++G+GIGGT E A +++K++L+ + V R P+ +I EL L EK Sbjct: 174 KKAGSDPCPPILVGVGIGGTFELAALLSKKALL-----RKVGQRHPRKYIAELEERLLEK 228 Query: 251 VNALGIGAQGLGGLATVLDVKIMAAPTHAASKPVAIIPNCAATRH 295 +N+LGIG +G GG T LDV I PTH A PVA+ C RH Sbjct: 229 INSLGIGPEGFGGKTTALDVFIEEFPTHIAGLPVAVNICCHVARH 273 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 278 Length adjustment: 30 Effective length of query: 490 Effective length of database: 248 Effective search space: 121520 Effective search space used: 121520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align fumarate hydratase (EC 4.2.1.2); (S)-2-methylmalate dehydratase (EC 4.2.1.34) (characterized)
to candidate WP_013404010.1 CALHY_RS10935 fumarate hydratase
Query= BRENDA::Q141Z6 (520 letters) >NCBI__GCF_000166355.1:WP_013404010.1 Length = 185 Score = 170 bits (431), Expect = 3e-47 Identities = 81/179 (45%), Positives = 116/179 (64%), Gaps = 1/179 (0%) Query: 330 RVDLNTLTPEEVAAWTPGQTLLLSGKMLTGRDAAHKRIADMLAKGEKLPVDFTNRVIYYV 389 R+ + PEE+ GQ +L+ GK+ RDAAHKR+ +M+ KG K+P+DF N IYY+ Sbjct: 3 RIYVPVQNPEEIQKLKCGQEVLVCGKLFVARDAAHKRLFEMIQKGSKIPIDFKNGAIYYM 62 Query: 390 GPVDPVRDEAVGPAGPTTATRMDKFTEMMLAQTGLISMIGKAERGPVAIEAIRKHKAAYL 449 GP E +GP GPTTA RMD FT MML + G+ +IGK +R EAI+KH + YL Sbjct: 63 GPCPEKPCEVIGPCGPTTAGRMDVFTPMML-ELGIKVLIGKGKRNEAVKEAIKKHGSIYL 121 Query: 450 MAVGGAAYLVSKAIRSAKVLAFEDLGMEAIYEFDVQDMPVTVAVDSNGTSVHQTGPKEW 508 GGAA L+ ++S +++ FEDLG EAI E +V+D+P VA+D G +++ GP+++ Sbjct: 122 ATFGGAAVLIQSCVKSQRIVMFEDLGAEAIREIEVEDLPCIVAIDGQGEDIYEVGPRKY 180 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 185 Length adjustment: 27 Effective length of query: 493 Effective length of database: 158 Effective search space: 77894 Effective search space used: 77894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory