Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_013402865.1 CALHY_RS04750 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000166355.1:WP_013402865.1 Length = 370 Score = 142 bits (359), Expect = 7e-39 Identities = 81/237 (34%), Positives = 134/237 (56%), Gaps = 5/237 (2%) Query: 2 IELKNVNKYY-GTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 + LK V K Y G + + NL +++ E +V++GPSG GK+TT+R + GLEEV+ GE+ + Sbjct: 4 VRLKGVYKRYPGGVTAVSDFNLDIEDKEFIVLVGPSGCGKTTTLRMIAGLEEVTEGEIYI 63 Query: 61 NNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYL 120 + ++N + + AMVFQ++ LYPHMTV +N+ +KL+K K E + + Sbjct: 64 GDKLVNDVPPKD---RDIAMVFQNYALYPHMTVFENMAFG-LKLRKFPKDEIKRRVHEAA 119 Query: 121 KVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKE 180 K++G+ + P LSGGQ+QRVA+ R++ + L DEP S LD + ++ + + Sbjct: 120 KILGIEHLLDRKPKALSGGQRQRVALGRAIVREPKVFLMDEPLSNLDAKLRVQMRTELSK 179 Query: 181 ISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLG 237 + + TT + VTH+ A + RI+ M+DG I + + P + P F+G Sbjct: 180 LHKRLGTTFIYVTHDQTEAMTMGTRIVVMKDGFIQQVDTPQVLYEQPANLFVAGFIG 236 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 370 Length adjustment: 27 Effective length of query: 215 Effective length of database: 343 Effective search space: 73745 Effective search space used: 73745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory