Align glycerol kinase (EC 2.7.1.30) (characterized)
to candidate WP_013402101.1 CALHY_RS00630 xylulokinase
Query= BRENDA::O93623 (497 letters) >NCBI__GCF_000166355.1:WP_013402101.1 Length = 497 Score = 223 bits (567), Expect = 2e-62 Identities = 154/485 (31%), Positives = 256/485 (52%), Gaps = 28/485 (5%) Query: 1 MEKFVLSLDEGTTSARAIIFDRESNIHGIGQYEFPQHYPRPGWVEHNPEEIWDAQLRAIK 60 MEK +L++D GTT+ + I+FD + NI E+P + P+ W E +P + W+ + IK Sbjct: 1 MEK-ILTIDIGTTACKVIVFDLQGNILAKANREYPTYTPQIEWAEQDPLDWWNEVVEGIK 59 Query: 61 DAIQSARIEPNQIAAIGVTNQRETTLVWDKDGKPLYNAIVWQCRRTAEMVEEIKREYGT- 119 + Q+A + I AIG+++QRET + DK+G L AI W RR+ EEI ++G Sbjct: 60 EVAQAAGADG--IVAIGLSSQRETVVPIDKEGNVLSRAISWMDRRSRLEAEEISHQFGKD 117 Query: 120 MIKEKTGLVPDAYFSASKLKWLLDNVPGLREKAEKGEVMFGTVDTFLIYRLTGEHVTDYS 179 I + TGL+PD+ F+A+KL WL + P + +KA +F F+ Y LTGE TD+S Sbjct: 118 TIHKITGLIPDSTFTATKLLWLKKHQPEILQKA----YIFLQPKEFIGYMLTGEAATDHS 173 Query: 180 NASRTMLFNIKKLDWDDELLELFDIPESVLPEVRESSEVYGYTKKEL-----LGAEIPVS 234 ASRTM+F++ K W +++ E + S P + + EV GY K+++ L + IPV Sbjct: 174 LASRTMMFDVNKRQWWEDIFEFVGVKTSQFPRLCYADEVIGYLKEDVAKILGLKSGIPVV 233 Query: 235 GDAGDQQAALFGQAAFEAGMVKATYGTGSFILVNTDKMVLYSDNLLTTIAWGLNGRVSYA 294 GD+ G + ++++T GT + + ++++K+ D + + R Y Sbjct: 234 SGGGDRPLEALGAGIVGSRVMEST-GTATNVSMSSNKVPESLDPRVVCSCHVI--RDHYL 290 Query: 295 LEGSIFVTGAAVQWLRDGI---KIIKHASETEELATKLESN----EGVYFVPAFVGLGAP 347 +E I +G ++W+RD + K + E + ++ ES+ GV +P F+G A Sbjct: 291 IEQGINTSGTILRWIRDNFYRGEKEKGENVYELIDSEAESSSPGANGVVLLPFFMGSRAT 350 Query: 348 YWDQFARGIIIGITRGTGREHLARATLEAIAYLTRDVVDEMEKL-VQIKELRVDGGATAN 406 W+ A+G++ G+T R +ARA LE I+Y R ++ +E + ++ + + GG + Sbjct: 351 RWNPDAKGVLFGLTLTHSRADIARAVLEGISYEIRACIEILESMGLKAESIVSMGGGAKS 410 Query: 407 DFLMQFQADILNRKVIRPVVKETTALGAAYLAGLAVDYWADTREIAELWKAERIFEPKMD 466 + +ADIL + V+ V+E + GA LA A+ RE K E +FE + D Sbjct: 411 RVWSKIKADILGKNVVVEKVQEAASKGAMLLASYAI----GARESLIEEKREVLFEYQPD 466 Query: 467 EKTRE 471 K E Sbjct: 467 SKNHE 471 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 28 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 497 Length adjustment: 34 Effective length of query: 463 Effective length of database: 463 Effective search space: 214369 Effective search space used: 214369 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory