Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 115 bits (288), Expect = 1e-30 Identities = 73/210 (34%), Positives = 123/210 (58%), Gaps = 9/210 (4%) Query: 1 MQLALDSISKKVGAQ----TWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTA 56 M LA++++SKK ++ T L ++L +Q G +LG + GK++L+ I+AGL+ P+ Sbjct: 1 MALAVENVSKKFLSKNKEITVLEKINLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSE 60 Query: 57 GRVTVDGKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKLRG--EKNIDARVREI 114 G+V ++GK++ P DR V ++Q+ +P +KV N+ +KLRG +K + + Sbjct: 61 GKVFLNGKEILS-PGPDRIV--MFQESALFPWLKVIDNVEFGMKLRGVPKKERYEKALKY 117 Query: 115 ASRLHIDMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELT 174 +H+ F D Y +LSGG +QRVALARAL + +ML+DEP LD + + L EL Sbjct: 118 LKMVHLTKFKDAYVHQLSGGMKQRVALARALTLDSEVMLMDEPFAALDSQTKNILLLELQ 177 Query: 175 QLFAAGQSTVVYATTEPGEALLLGGYTAVL 204 +++ + T+++ T EA+LL V+ Sbjct: 178 RIWWETKKTIIFVTHNIEEAVLLADKVVVM 207 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 279 Length adjustment: 27 Effective length of query: 336 Effective length of database: 252 Effective search space: 84672 Effective search space used: 84672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory