Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= TCDB::G3LHY8 (358 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 119 bits (298), Expect = 1e-31 Identities = 74/232 (31%), Positives = 125/232 (53%), Gaps = 9/232 (3%) Query: 1 MLELRNAAKMV---GADYHIYPT-DLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGG 56 M+ ++N K+ G D +L +E+G + ++GP+ AGK++L+R + L++PT G Sbjct: 1 MIRIKNLTKIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHG 60 Query: 57 SIHFDGTDVTGM-PVQ----KRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDRE 111 SI DG ++T + P + ++ V +++Q F + TV N+A P+ I+G D TID Sbjct: 61 SIEIDGVEMTKLSPTELKEMRKKVGIIFQHFNLLSSRTVKGNVAFPLEIAGLDKKTIDNR 120 Query: 112 VRKAAELLKLTPYLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELR 171 V++ EL+ LT D P LSGGQ+QR +ARAL N ++L DE + LD + + Sbjct: 121 VKELLELVGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSIL 180 Query: 172 EELPKIFAQSGAIFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRP 223 L +I + G V T E + + A + +G++ + G E++ P Sbjct: 181 NLLKEINREFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFANP 232 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 343 Length adjustment: 29 Effective length of query: 329 Effective length of database: 314 Effective search space: 103306 Effective search space used: 103306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory