Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 298 bits (764), Expect = 1e-85 Identities = 161/341 (47%), Positives = 226/341 (66%), Gaps = 8/341 (2%) Query: 1 MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGG 60 MI ++ K Y G +I AL LNI+ G IFG+IG SGAGKSTL+R IN LE+P+ G Sbjct: 1 MIRIKNLTKIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHG 60 Query: 61 RILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDA 120 I ++G ++T L L+ R++VG+IFQHFNLLSS+TV N+A PL +AG + +D Sbjct: 61 SIEIDGVEMTKLSPTELKEMRKKVGIIFQHFNLLSSRTVKGNVAFPLEIAG-LDKKTIDN 119 Query: 121 RVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASV 180 RV ELL VGL++ YP+QLSGGQKQRVGIARALA P +LLCDEATSALDP+TT S+ Sbjct: 120 RVKELLELVGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSI 179 Query: 181 LQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRR 240 L LL EINRE +TIV++THEM+V++++C++VAVM+ G IVEQG + ++F +P+ + Sbjct: 180 LNLLKEINREFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFANPKTKIAQN 239 Query: 241 FVFE------AERVDEDERHDDFAHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILS 294 F+ E + + R+ H+ I+++ F GE T P+L +V ++ VD ++L Sbjct: 240 FLRSLTFSELPEELKDKIRNLHRGHLEWKIVKINFFGEVTAEPILTSVIKKFDVDINVLY 299 Query: 295 GRIDRIKDTPYGQLTLALVGGD-LEAAMSQLNAADVHVEVL 334 G ID I+ PYG L + L G + +E + L + VEV+ Sbjct: 300 GNIDHIQGIPYGTLIVELRGNNKIEGVLRYLQELGLEVEVI 340 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 343 Length adjustment: 28 Effective length of query: 307 Effective length of database: 315 Effective search space: 96705 Effective search space used: 96705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory