Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_013402768.1 CALHY_RS04225 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_000166355.1:WP_013402768.1 Length = 261 Score = 249 bits (636), Expect = 4e-71 Identities = 132/241 (54%), Positives = 175/241 (72%), Gaps = 2/241 (0%) Query: 13 KRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLV 72 K +G + VL VSL+ N G+V+ IIG SGSGKSTFLRC+N LE+ + G I ++G I Sbjct: 20 KYFGHNLVLDKVSLEVNRGEVVVIIGPSGSGKSTFLRCLNHLERINSGYIEIDGFVIEDK 79 Query: 73 RDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERA 132 + K + K R +++ MVFQ FNL+ HMT LENV+ P+ V + K+EA E Sbjct: 80 GFHEKHKKHSSKEIARFC-SQIGMVFQRFNLFPHMTALENVIVGPVVVNKMKKEEAVELG 138 Query: 133 VKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVL 192 ++ L KVG+ ++A YP LSGGQQQRV+IARALAM+P+V+LFDEPTSALDPELVGEVL Sbjct: 139 MELLEKVGLKDKANS-YPAQLSGGQQQRVAIARALAMKPKVMLFDEPTSALDPELVGEVL 197 Query: 193 RIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPRLQRFL 252 +M++LAEEG TM+VVTHEMGFAR V+ V+F+ +GKI EEG PE++F NP+ R ++FL Sbjct: 198 NVMKELAEEGMTMLVVTHEMGFAREVADRVVFMDKGKIVEEGLPEEIFTNPKQERTRQFL 257 Query: 253 K 253 + Sbjct: 258 Q 258 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 261 Length adjustment: 24 Effective length of query: 233 Effective length of database: 237 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory