Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_013402768.1 CALHY_RS04225 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000166355.1:WP_013402768.1 Length = 261 Score = 149 bits (375), Expect = 8e-41 Identities = 89/245 (36%), Positives = 140/245 (57%), Gaps = 12/245 (4%) Query: 32 DILSRSGCTVGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNI 91 +I+ G + L+ VSL++ G++ VI+G SGSGKST +R +N L SG + DG I Sbjct: 17 NIVKYFGHNLVLDKVSLEVNRGEVVVIIGPSGSGKSTFLRCLNHLERINSGYIEIDGFVI 76 Query: 92 LDLG---------AKALRAFRMRRVSMVFQSFALMPHRTVLQNVVYGQRV-RGVSKDDAR 141 D G +K + F ++ MVFQ F L PH T L+NV+ G V + K++A Sbjct: 77 EDKGFHEKHKKHSSKEIARF-CSQIGMVFQRFNLFPHMTALENVIVGPVVVNKMKKEEAV 135 Query: 142 EIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGD 201 E+GM+ ++ VGL +P QLSGG +QRV +ARALA V+L DE SALDP + G+ Sbjct: 136 ELGMELLEKVGLKDKANSYPAQLSGGQQQRVAIARALAMKPKVMLFDEPTSALDPELVGE 195 Query: 202 MQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVA 261 + + + +L T++ +TH++ A + + + G++V+ G P +I NP + Sbjct: 196 VLNVMKELAEE-GMTMLVVTHEMGFAREVADRVVFMDKGKIVEEGLPEEIFTNPKQERTR 254 Query: 262 RFVQR 266 +F+Q+ Sbjct: 255 QFLQK 259 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 261 Length adjustment: 25 Effective length of query: 250 Effective length of database: 236 Effective search space: 59000 Effective search space used: 59000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory