Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_013402865.1 CALHY_RS04750 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000166355.1:WP_013402865.1 Length = 370 Score = 148 bits (374), Expect = 1e-40 Identities = 85/230 (36%), Positives = 129/230 (56%), Gaps = 12/230 (5%) Query: 43 GCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGE---DILQL 99 G V V+D +L I E V++G SG GK+T +R L + T G I + + D+ Sbjct: 15 GGVTAVSDFNLDIEDKEFIVLVGPSGCGKTTTLRMIAGLEEVTEGEIYIGDKLVNDVPPK 74 Query: 100 DMDALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLK 159 D D I+MVFQ++ L PH +V +N+A+GLK+R K R +G++ Sbjct: 75 DRD---------IAMVFQNYALYPHMTVFENMAFGLKLRKFPKDEIKRRVHEAAKILGIE 125 Query: 160 GYENKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLH 219 ++ P LSGG RQRV L RA+ + + LMDE S LD +R +M+ +L +L K L Sbjct: 126 HLLDRKPKALSGGQRQRVALGRAIVREPKVFLMDEPLSNLDAKLRVQMRTELSKLHKRLG 185 Query: 220 KTIVFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 T +++THD EA+ +G RI ++KDG + QV TP+ + PA+ +V F+ Sbjct: 186 TTFIYVTHDQTEAMTMGTRIVVMKDGFIQQVDTPQVLYEQPANLFVAGFI 235 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 370 Length adjustment: 28 Effective length of query: 248 Effective length of database: 342 Effective search space: 84816 Effective search space used: 84816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory