Align ABC transporter for L-Histidine, permease component (characterized)
to candidate WP_013403449.1 CALHY_RS07945 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >NCBI__GCF_000166355.1:WP_013403449.1 Length = 217 Score = 87.0 bits (214), Expect = 3e-22 Identities = 63/198 (31%), Positives = 109/198 (55%), Gaps = 21/198 (10%) Query: 94 QTLALMLVATLISVLIGIPLGILSARSNR--------LRSVLMPLLDIMQTMPSFVYLIP 145 QT+ +++++TLI+ ++GIPLG+ +++ L +L +++I +++P FV L+ Sbjct: 14 QTIYMVVISTLIATVLGIPLGVFLMVTDKGQILQNDILNKILSTIVNIFRSIP-FVILLI 72 Query: 146 VLMLF-------GLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQ 198 VLM F +G AI I A P + R+T+ +R+VD V+EA A GA+ +Q Sbjct: 73 VLMPFTRLIVGTSIGTTAAIVPLSIAAIPFMGRITETALREVDHGVIEAAQAMGASPFQI 132 Query: 199 LFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGE-DVLVGIQTLNVGRGLEAG 257 + V +P ALPSI++GI T + + +A +IG GLG+ V G Q + + Sbjct: 133 ITKVLIPEALPSIVSGITITAINLVGYSAMAGVIGGGGLGDLAVRYGYQRFMI----DIM 188 Query: 258 LAIVILAVVIDRITQAYG 275 L V + + + ++TQ G Sbjct: 189 LWTVAILIAMVQLTQLIG 206 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 217 Length adjustment: 24 Effective length of query: 259 Effective length of database: 193 Effective search space: 49987 Effective search space used: 49987 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory