Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_013402971.1 CALHY_RS05375 energy-coupling factor transporter ATPase
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000166355.1:WP_013402971.1 Length = 278 Score = 102 bits (255), Expect = 6e-27 Identities = 70/231 (30%), Positives = 118/231 (51%), Gaps = 7/231 (3%) Query: 1 MSDLLVVKDVFAGYVAD----VPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLT 56 MS + K+V YV+ P L IN I GE V ++G NG+GKSTLAK I GLL Sbjct: 1 MSAFIEFKNVSFSYVSSDGTKTPALIDINLKIERGEFVAILGLNGSGKSTLAKLINGLLI 60 Query: 57 PSQGEIIFKGENITGLGSDQIVRRGMCYVPQ-VCNVFGSLTVAENLDMGAFLHQGPTQTL 115 P +G++I N + +RR Y+ Q N + V E++ G P + + Sbjct: 61 PEKGDVIVDSMNTKDVEKIWDIRRKCGYIFQNPDNQLVASIVEEDVAFGPENLGMPREKI 120 Query: 116 KDRIYT--MFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVK 173 + + + + ++ + +N LSGG++Q +A+ L + P+ ++LDEP++ L P K Sbjct: 121 RKAVDSALLTVEMMEYKNHATYKLSGGQKQRVAIAGVLAMKPECIILDEPTSMLDPKGRK 180 Query: 174 DVFAQIKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLL 224 +V A ++ +N K I++ + ++++ R VL+ G K +G LL Sbjct: 181 EVIATVERLNKEEKKTIVLVTHNIDEMLLSQRSIVLDKGHIKFDGPSFELL 231 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 278 Length adjustment: 24 Effective length of query: 216 Effective length of database: 254 Effective search space: 54864 Effective search space used: 54864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory