Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_013402459.1 CALHY_RS02575 SDR family oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000166355.1:WP_013402459.1 Length = 255 Score = 124 bits (311), Expect = 2e-33 Identities = 91/267 (34%), Positives = 134/267 (50%), Gaps = 35/267 (13%) Query: 9 KGLVAVITGGASGLGLATAERLVGQGASAVL----LDLPNSGGEA--QAKKLGNNCVFAP 62 K V +ITG SG+G TA GA + L+ +G + +K+G C+F Sbjct: 4 KDKVVLITGATSGIGRTTAVLYAKYGAKVAVNGRELNKDKNGETTIDEIRKIGGECIFIQ 63 Query: 63 ADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNL 122 DV+ D Q + K+G++D+ VN AGI + + N+ + EDF + + VN+ Sbjct: 64 GDVSKNDDAQRIVMETVEKYGKIDILVNNAGIVLPGRVDNMSE------EDFDKTMAVNV 117 Query: 123 MGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPI 182 G F V + +M + QG +GVI+N ASVAA +G ++AYSASKG IV +T + Sbjct: 118 KGAFLVSKYAVLQMKK----QG--KGVIVNVASVAALKGHTDRSAYSASKGAIVSLTKAM 171 Query: 183 ARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCN----------FLASQVPFPSRLGDPAE 232 A D IRV + P GT L ++ EK+ N F+A Q RLG P E Sbjct: 172 AADYVKDNIRVNCVCP---GTTLTPAVEEKIVNAPDPEAMRAAFIARQP--MGRLGRPEE 226 Query: 233 --YAHLVQAIIENPFLNGEVIRLDGAI 257 +A L + E F+NG +I +DG + Sbjct: 227 IAFAILFASCDEAEFMNGSIIVIDGGM 253 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory