Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 132 bits (332), Expect = 1e-35 Identities = 79/227 (34%), Positives = 132/227 (58%), Gaps = 10/227 (4%) Query: 17 KEPTV-KKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPR 75 KE TV +K NLEI GEF+ ++GPSGCGKST L ++AGLE ++G +F+ K++ P Sbjct: 17 KEITVLEKINLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSEGKVFLNGKEILSPGP- 75 Query: 76 DRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKA 135 D ++FQ AL+P + V +N+ F +K+ G + E ++ + + LT+F + Sbjct: 76 --DRIVMFQESALFPWLKVIDNVEFGMKLRGVPKKERYEKALKYLKMVHLTKFKDAYVHQ 133 Query: 136 LSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHD 195 LSGG +QRVA+ RA+ + +V LMDEP + LD++ + ++ + + T ++VTH+ Sbjct: 134 LSGGMKQRVALARALTLDSEVMLMDEPFAALDSQTKNILLLELQRIWWETKKTIIFVTHN 193 Query: 196 QTEALTMGDRIAVLKD--GYLQQVGAPR----ELYDRPANVFVAGFI 236 EA+ + D++ V+ G +++V R L D P V++ I Sbjct: 194 IEEAVLLADKVVVMSSNPGKIKKVFEIRLARPRLIDNPDIVYMISAI 240 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 279 Length adjustment: 28 Effective length of query: 348 Effective length of database: 251 Effective search space: 87348 Effective search space used: 87348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory